Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human SAMD4A Monoclonal Antibody | anti-SAMD4A antibody

SAMD4A (Sterile alpha Motif Domain-containing Protein 4A, SAM domain-containing Protein 4A, SAMD4, KIAA1053, Protein Smaug Homolog 1, Smaug 1, SMAUG1, hSmaug1, SMAUG, SMG, SMGA) (PE)

Gene Names
SAMD4A; SMG; SMGA; SAMD4; SMAUG; SMAUG1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SAMD4A; Monoclonal Antibody; SAMD4A (Sterile alpha Motif Domain-containing Protein 4A; SAM domain-containing Protein 4A; SAMD4; KIAA1053; Protein Smaug Homolog 1; Smaug 1; SMAUG1; hSmaug1; SMAUG; SMG; SMGA) (PE); anti-SAMD4A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A4
Specificity
Recognizes human SAMD4A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
7157
Applicable Applications for anti-SAMD4A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa161-270 from SAMD4A (NP_056404) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NRGRSDSVDYGQTHYYHQRQNSDDKLNGWQNSRDSGICINASNWQDKSMGCENGHVPLYSSSSVPTTINTIGTSTSTILSGQAHHSPLKRSVSLTPPMNVPNQPLGHGWM*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Testing Data

(Detection limit for recombinant GST tagged SAMD4A is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SAMD4A is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SAMD4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens sterile alpha motif domain containing 4A (SAMD4A), transcript variant 1, mRNA
NCBI Official Synonym Full Names
sterile alpha motif domain containing 4A
NCBI Official Symbol
SAMD4A
NCBI Official Synonym Symbols
SMG; SMGA; SAMD4; SMAUG; SMAUG1
NCBI Protein Information
protein Smaug homolog 1
UniProt Protein Name
Protein Smaug homolog 1
Protein Family
UniProt Gene Name
SAMD4A
UniProt Synonym Gene Names
KIAA1053; SAMD4; SMAUG1; Smaug 1; hSmaug1
UniProt Entry Name
SMAG1_HUMAN

NCBI Description

Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein (Baez and Boccaccio, 2005 [PubMed 16221671]).[supplied by OMIM, Mar 2008]

Uniprot Description

Function: Acts as a translational repressor of SRE-containing messengers. Ref.6

Subcellular location: Cytoplasm. Cell projection › dendrite

By similarity. Cell junction › synapse › synaptosome

By similarity. Note: Enriched in synaptoneurosomes

By similarity. Shuttles between the nucleus and the cytoplasm in a CRM1-dependent manner. Colocalizes throughout the cytoplasm in granules with polyadenylated RNAs, PABPC1 and STAU1. Also frequently colocalizes in cytoplasmic stress granule-like foci with ELAVL1, TIA1 and TIAL1. Ref.6

Sequence similarities: Belongs to the SMAUG family.Contains 1 SAM (sterile alpha motif) domain.

Sequence caution: The sequence AAH57838.1 differs from that shown. Reason: Intron retention.The sequence AAP97302.1 differs from that shown. Reason: Intron retention.

Research Articles on SAMD4A

Similar Products

Product Notes

The SAMD4A samd4a (Catalog #AAA6160116) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SAMD4A (Sterile alpha Motif Domain-containing Protein 4A, SAM domain-containing Protein 4A, SAMD4, KIAA1053, Protein Smaug Homolog 1, Smaug 1, SMAUG1, hSmaug1, SMAUG, SMG, SMGA) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SAMD4A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SAMD4A samd4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SAMD4A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.