Mouse anti-Human SAMD4A Monoclonal Antibody | anti-SAMD4A antibody

SAMD4A (Sterile alpha Motif Domain-containing Protein 4A, SAM domain-containing Protein 4A, SAMD4, KIAA1053, Protein Smaug Homolog 1, Smaug 1, SMAUG1, hSmaug1, SMAUG, SMG, SMGA) (FITC)

Cat. Num. AAA6149510

• Gene Names: SAMD4A; SMG; SMGA; SAMD4; SMAUG; SMAUG1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SAMD4A; Monoclonal Antibody; SAMD4A (Sterile alpha Motif Domain-containing Protein 4A; SAM domain-containing Protein 4A; SAMD4; KIAA1053; Protein Smaug Homolog 1; Smaug 1; SMAUG1; hSmaug1; SMAUG; SMG; SMGA) (FITC); anti-SAMD4A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1A4
• Specificity: Recognizes human SAMD4A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 7157

• Applicable Applications for anti-SAMD4A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa161-270 from SAMD4A (NP_056404) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NRGRSDSVDYGQTHYYHQRQNSDDKLNGWQNSRDSGICINASNWQDKSMGCENGHVPLYSSSSVPTTINTIGTSTSTILSGQAHHSPLKRSVSLTPPMNVPNQPLGHGWM*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Testing Data

(Detection limit for recombinant GST tagged SAMD4A is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-SAMD4A antibody

Antibodies; DNA/RNA Translation

NCBI and Uniprot Product Information

• NCBI GI #: 1708342410
• NCBI GeneID: 23034
• NCBI Accession #: NM_015589.6
• NCBI GenBank Nucleotide #: NM_015589
• UniProt Accession #: Q9UPU9
• NCBI Official Full Name: Homo sapiens sterile alpha motif domain containing 4A (SAMD4A), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: sterile alpha motif domain containing 4A
• NCBI Official Symbol: SAMD4A
• NCBI Official Synonym Symbols: SMG; SMGA; SAMD4; SMAUG; SMAUG1
• NCBI Protein Information: protein Smaug homolog 1
• UniProt Protein Name: Protein Smaug homolog 1
• Protein Family: Protein
• UniProt Gene Name: SAMD4A
• UniProt Synonym Gene Names: KIAA1053; SAMD4; SMAUG1; Smaug 1; hSmaug1
• UniProt Entry Name: SMAG1_HUMAN

NCBI Description

Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein (Baez and Boccaccio, 2005 [PubMed 16221671]).[supplied by OMIM, Mar 2008]

Uniprot Description

Function: Acts as a translational repressor of SRE-containing messengers. Ref.6

Subcellular location: Cytoplasm. Cell projection › dendrite

By similarity. Cell junction › synapse › synaptosome

By similarity. Note: Enriched in synaptoneurosomes

By similarity. Shuttles between the nucleus and the cytoplasm in a CRM1-dependent manner. Colocalizes throughout the cytoplasm in granules with polyadenylated RNAs, PABPC1 and STAU1. Also frequently colocalizes in cytoplasmic stress granule-like foci with ELAVL1, TIA1 and TIAL1. Ref.6

Sequence similarities: Belongs to the SMAUG family.Contains 1 SAM (sterile alpha motif) domain.

Sequence caution: The sequence AAH57838.1 differs from that shown. Reason: Intron retention.The sequence AAP97302.1 differs from that shown. Reason: Intron retention.