Mouse S100A6 Monoclonal Antibody | anti-S100A6 antibody

S100A6 (S100 Calcium Binding Protein A6, 2A9, 5B10, CABP, CACY, PRA) (FITC)

Cat. Num. AAA6174952

• Gene Names: S100A6; 2A9; PRA; 5B10; CABP; CACY; S10A6
• Applications: Western Blot
• Purity: Purified
• Synonyms: S100A6; Monoclonal Antibody; S100A6 (S100 Calcium Binding Protein A6; 2A9; 5B10; CABP; CACY; PRA) (FITC); S100 Calcium Binding Protein A6; PRA; anti-S100A6 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6D1
• Specificity: Recognizes S100A6.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-S100A6 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: S100A6 (NP_055439, 18aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYSEALKG
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(S100A6 monoclonal antibody (M16), clone 6D1 Western Blot analysis of S100A6 expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged S100A6 is approximately 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of S100A6 expression in transfected 293T cell line by S100A6 monoclonal antibody (M16), clone 6D1.Lane 1: S100A6 transfected lysate (10.2 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-S100A6 antibody

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq]

Product Categories/Family for anti-S100A6 antibody

Antibodies; Binding Proteins; Calcium

References

1. Cancer-Initiating Cells from Colorectal Cancer Patients Escape from T Cell-Mediated Immunosurveillance In Vitro through Membrane-Bound IL-4.Volonte A, Di Tomaso T, Spinelli M, Todaro M, Sanvito F, Albarello L, Bissolati M, Ghirardelli L, Orsenigo E, Ferrone S, Doglioni C, Stassi G, Dellabona P, Staudacher C, Parmiani G, Maccalli CJ Immunol. 2013 Nov 25. 2.S100A6 Overexpression Associates with Poor Prognosis and Is Epigenetically Up-Regulated in Gastric Cancer.Wang XH, Zhang LH, Zhong XY, Xing XF, Liu YQ, Niu ZJ, Peng Y, Du H, Zhang GG, Hu Y, Liu N, Zhu YB, Ge SH, Zhao W, Lu AP, Li JY, Ji JF.Am J Pathol. 2010 Jun 25. 3.Immunobiological Characterization of Cancer Stem Cells Isolated from Glioblastoma Patients.Di Tomaso T, Mazzoleni S, Wang E, Sovena G, Clavenna D, Franzin A, Mortini P, Ferrone S, Doglioni C, Marincola FM, Galli R, Parmiani G, Maccalli C.Clin Cancer Res. 2010 Feb 1;16(3):800-13. Epub 2010 Jan 26.

NCBI and Uniprot Product Information

• NCBI GI #: 7657532
• NCBI GeneID: 6277
• NCBI Accession #: NP_055439
• NCBI GenBank Nucleotide #: NM_014624.3
• UniProt Accession #: P06703; Q5RHS4; D3DV39
• Molecular Weight: 12.3 kDa (110aa) confirmed by MALDI-TOF
• NCBI Official Full Name: protein S100-A6
• NCBI Official Synonym Full Names: S100 calcium binding protein A6
• NCBI Official Symbol: S100A6
• NCBI Official Synonym Symbols: 2A9; PRA; 5B10; CABP; CACY; S10A6
• NCBI Protein Information: protein S100-A6
• UniProt Protein Name: Protein S100-A6
• Protein Family: Protein
• UniProt Gene Name: S100A6
• UniProt Synonym Gene Names: CACY; PRA
• UniProt Entry Name: S10A6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq, Jul 2008]

Uniprot Description

S100A6: May function as calcium sensor and contribute to cellular calcium signaling (Potential). May function by interacting with other proteins and indirectly play a role in the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative. Belongs to the S-100 family.

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: ruffle; extrinsic to internal side of plasma membrane; perinuclear region of cytoplasm; cytoplasm; nuclear envelope; nucleus; cytosol

Molecular Function: protein binding; protein homodimerization activity; zinc ion binding; ion transmembrane transporter activity; calcium ion binding; tropomyosin binding; calcium-dependent protein binding

Biological Process: positive regulation of fibroblast proliferation; axonogenesis; signal transduction