Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (S100A6 monoclonal antibody (M16), clone 6D1 Western Blot analysis of S100A6 expression in HeLa (Cat # L013V1).)

Mouse S100A6 Monoclonal Antibody | anti-S100A6 antibody

S100A6 (S100 Calcium Binding Protein A6, 2A9, 5B10, CABP, CACY, PRA) (HRP)

Gene Names
S100A6; 2A9; PRA; 5B10; CABP; CACY; S10A6
Applications
Western Blot
Purity
Purified
Synonyms
S100A6; Monoclonal Antibody; S100A6 (S100 Calcium Binding Protein A6; 2A9; 5B10; CABP; CACY; PRA) (HRP); S100 Calcium Binding Protein A6; PRA; anti-S100A6 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D1
Specificity
Recognizes S100A6.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-S100A6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
S100A6 (NP_055439, 18aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYSEALKG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(S100A6 monoclonal antibody (M16), clone 6D1 Western Blot analysis of S100A6 expression in HeLa (Cat # L013V1).)

Western Blot (WB) (S100A6 monoclonal antibody (M16), clone 6D1 Western Blot analysis of S100A6 expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged S100A6 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged S100A6 is approximately 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of S100A6 expression in transfected 293T cell line by S100A6 monoclonal antibody (M16), clone 6D1.Lane 1: S100A6 transfected lysate (10.2 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of S100A6 expression in transfected 293T cell line by S100A6 monoclonal antibody (M16), clone 6D1.Lane 1: S100A6 transfected lysate (10.2 KDa).Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-S100A6 antibody
References
1. Cancer-Initiating Cells from Colorectal Cancer Patients Escape from T Cell-Mediated Immunosurveillance In Vitro through Membrane-Bound IL-4.Volonte A, Di Tomaso T, Spinelli M, Todaro M, Sanvito F, Albarello L, Bissolati M, Ghirardelli L, Orsenigo E, Ferrone S, Doglioni C, Stassi G, Dellabona P, Staudacher C, Parmiani G, Maccalli CJ Immunol. 2013 Nov 25. 2.S100A6 Overexpression Associates with Poor Prognosis and Is Epigenetically Up-Regulated in Gastric Cancer.Wang XH, Zhang LH, Zhong XY, Xing XF, Liu YQ, Niu ZJ, Peng Y, Du H, Zhang GG, Hu Y, Liu N, Zhu YB, Ge SH, Zhao W, Lu AP, Li JY, Ji JF.Am J Pathol. 2010 Jun 25. 3.Immunobiological Characterization of Cancer Stem Cells Isolated from Glioblastoma Patients.Di Tomaso T, Mazzoleni S, Wang E, Sovena G, Clavenna D, Franzin A, Mortini P, Ferrone S, Doglioni C, Marincola FM, Galli R, Parmiani G, Maccalli C.Clin Cancer Res. 2010 Feb 1;16(3):800-13. Epub 2010 Jan 26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.3 kDa (110aa) confirmed by MALDI-TOF
NCBI Official Full Name
protein S100-A6
NCBI Official Synonym Full Names
S100 calcium binding protein A6
NCBI Official Symbol
S100A6
NCBI Official Synonym Symbols
2A9; PRA; 5B10; CABP; CACY; S10A6
NCBI Protein Information
protein S100-A6
UniProt Protein Name
Protein S100-A6
Protein Family
UniProt Gene Name
S100A6
UniProt Synonym Gene Names
CACY; PRA
UniProt Entry Name
S10A6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq, Jul 2008]

Uniprot Description

S100A6: May function as calcium sensor and contribute to cellular calcium signaling (Potential). May function by interacting with other proteins and indirectly play a role in the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative. Belongs to the S-100 family.

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: ruffle; extrinsic to internal side of plasma membrane; perinuclear region of cytoplasm; cytoplasm; nuclear envelope; nucleus; cytosol

Molecular Function: protein binding; protein homodimerization activity; zinc ion binding; ion transmembrane transporter activity; calcium ion binding; tropomyosin binding; calcium-dependent protein binding

Biological Process: positive regulation of fibroblast proliferation; axonogenesis; signal transduction

Research Articles on S100A6

Similar Products

Product Notes

The S100A6 s100a6 (Catalog #AAA6179362) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's S100A6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the S100A6 s100a6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "S100A6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.