Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RUNX1T1 expression in transfected 293T cell line by RUNX1T1 monoclonal antibody. Lane 1: RUNX1T1 transfected lysate (67.566kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human RUNX1T1 Monoclonal Antibody | anti-RUNX1T1 antibody

RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (Biotin)

Gene Names
RUNX1T1; CDR; ETO; MTG8; AML1T1; ZMYND2; CBFA2T1; AML1-MTG8
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RUNX1T1; Monoclonal Antibody; RUNX1T1 (Protein CBFA2T1; Cyclin-D-related Protein; Eight Twenty One Protein; Protein ETO; Protein MTG8; Zinc Finger MYND Domain-containing Protein 2; AML1T1; CBFA2T1; CDR; ETO; MTG8; ZMYND2) (Biotin); anti-RUNX1T1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5A12
Specificity
Recognizes human RUNX1T1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RUNX1T1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa416-525 from human RUNX1T1 (NP_004340) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RUNX1T1 expression in transfected 293T cell line by RUNX1T1 monoclonal antibody. Lane 1: RUNX1T1 transfected lysate (67.566kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RUNX1T1 expression in transfected 293T cell line by RUNX1T1 monoclonal antibody. Lane 1: RUNX1T1 transfected lysate (67.566kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RUNX1T1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RUNX1T1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged RUNX1T1 is ~0.3ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged RUNX1T1 is ~0.3ng/ml as a capture antibody)
Product Categories/Family for anti-RUNX1T1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
862
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
protein CBFA2T1 isoform A
NCBI Official Synonym Full Names
RUNX1 translocation partner 1
NCBI Official Symbol
RUNX1T1
NCBI Official Synonym Symbols
CDR; ETO; MTG8; AML1T1; ZMYND2; CBFA2T1; AML1-MTG8
NCBI Protein Information
protein CBFA2T1
Protein Family

NCBI Description

This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]

Research Articles on RUNX1T1

Similar Products

Product Notes

The RUNX1T1 (Catalog #AAA6144179) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RUNX1T1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RUNX1T1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RUNX1T1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.