Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human RPS6KC1 Monoclonal Antibody | anti-RPS6KC1 antibody

RPS6KC1 (Ribosomal Protein S6 Kinase delta-1, S6K-delta-1, 52kD Ribosomal Protein S6 Kinase, Ribosomal S6 Kinase-like Protein with Two PSK Domains 118kD Protein, RPK118, SPHK1-binding Protein, humS6PKh1) APC

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RPS6KC1; Monoclonal Antibody; RPS6KC1 (Ribosomal Protein S6 Kinase delta-1; S6K-delta-1; 52kD Ribosomal Protein S6 Kinase; Ribosomal S6 Kinase-like Protein with Two PSK Domains 118kD Protein; RPK118; SPHK1-binding Protein; humS6PKh1) APC; EC=2.7.11.1; anti-RPS6KC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C6
Specificity
Recognizes human RPS6KC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1066
Applicable Applications for anti-RPS6KC1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa957-1067 from human (NP_036556) RPS6KC1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SCDSDAIERMYCAPEVGAITEETEACDWWSLGAVLFELLTGKTLVECHPAGINTHTTLNMPECVSEEARSLIQQLLQFNPLERLGAGVAGVEDIKSHPFFTPVDWAELMR*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)
Product Categories/Family for anti-RPS6KC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ribosomal protein S6 kinase delta-1 isoform a
UniProt Protein Name
Ribosomal protein S6 kinase delta-1
UniProt Gene Name
RPS6KC1
UniProt Synonym Gene Names
RPK118; S6K-delta-1
UniProt Entry Name
KS6C1_HUMAN

Uniprot Description

RSKL1: an AGC kinase of the RSKL family.

Protein type: Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; Protein kinase, AGC; AGC group; RSKL family

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: intracellular membrane-bound organelle; membrane; early endosome; cytoplasm

Molecular Function: protein serine/threonine kinase activity; protein binding; phosphoinositide binding; ATP binding

Biological Process: signal transduction; protein amino acid phosphorylation

Similar Products

Product Notes

The RPS6KC1 rps6kc1 (Catalog #AAA6138849) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPS6KC1 (Ribosomal Protein S6 Kinase delta-1, S6K-delta-1, 52kD Ribosomal Protein S6 Kinase, Ribosomal S6 Kinase-like Protein with Two PSK Domains 118kD Protein, RPK118, SPHK1-binding Protein, humS6PKh1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPS6KC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPS6KC1 rps6kc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPS6KC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.