Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human ROCK2 Monoclonal Antibody | anti-ROCK2 antibody

ROCK2 (Rho-associated Protein Kinase 2, Rho Kinase 2, Rho-associated, Coiled-coil-containing Protein Kinase 2, p164 ROCK-2, KIAA0619) (AP)

Gene Names
ROCK2; ROCK-II
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ROCK2; Monoclonal Antibody; ROCK2 (Rho-associated Protein Kinase 2; Rho Kinase 2; Rho-associated; Coiled-coil-containing Protein Kinase 2; p164 ROCK-2; KIAA0619) (AP); anti-ROCK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2A4
Specificity
Recognizes human ROCK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
8345
Applicable Applications for anti-ROCK2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1279-1388 from ROCK2 (NP_004841) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(ROCK2 monoclonal antibody Western Blot analysis of ROCK2 expression in HeLa)

Western Blot (WB) (ROCK2 monoclonal antibody Western Blot analysis of ROCK2 expression in HeLa)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ROCK2 on HeLa cell. [antibody concentration 10ug/ml)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ROCK2 on HeLa cell. [antibody concentration 10ug/ml)
Product Categories/Family for anti-ROCK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens Rho associated coiled-coil containing protein kinase 2 (ROCK2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
Rho associated coiled-coil containing protein kinase 2
NCBI Official Symbol
ROCK2
NCBI Official Synonym Symbols
ROCK-II
NCBI Protein Information
rho-associated protein kinase 2
UniProt Protein Name
Rho-associated protein kinase 2
UniProt Gene Name
ROCK2
UniProt Synonym Gene Names
KIAA0619; ROCK-II
UniProt Entry Name
ROCK2_HUMAN

NCBI Description

The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho. [provided by RefSeq, Jul 2008]

Uniprot Description

ROCK2: Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus. Homodimer. Interacts with IRS1, RHOB and RHOC. Interacts with RHOA (activated by GTP), PPP1R12A, CHORDC1, SORL1, EP300 and BRCA2. Interacts with NPM1 and this interaction enhances its activity. Interacts with RAF1. Activated by RHOA binding. Inhibited by Y-27632. Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.

Protein type: Kinase, protein; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Protein kinase, AGC; AGC group; DMPK family; ROCK subfamily

Chromosomal Location of Human Ortholog: 2p24

Cellular Component: centrosome; plasma membrane; spindle pole centrosome; cytosol; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; Rho GTPase binding; metal ion binding; structural molecule activity; ATP binding

Biological Process: regulation of cell adhesion; axon guidance; dendrite morphogenesis; rhythmic process; cytokinesis; regulation of circadian rhythm; protein amino acid phosphorylation; Rho protein signal transduction; negative regulation of angiogenesis; smooth muscle contraction; induction of apoptosis via death domain receptors; regulation of stress fiber formation; regulation of actin cytoskeleton organization and biogenesis; neural tube closure; regulation of focal adhesion formation; ephrin receptor signaling pathway; vascular endothelial growth factor receptor signaling pathway; actin cytoskeleton organization and biogenesis; regulation of keratinocyte differentiation; centrosome duplication

Research Articles on ROCK2

Similar Products

Product Notes

The ROCK2 rock2 (Catalog #AAA6133492) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ROCK2 (Rho-associated Protein Kinase 2, Rho Kinase 2, Rho-associated, Coiled-coil-containing Protein Kinase 2, p164 ROCK-2, KIAA0619) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ROCK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ROCK2 rock2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ROCK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.