Mouse anti-Human ROCK2 Monoclonal Antibody | anti-ROCK2 antibody

ROCK2 (Rho-associated Protein Kinase 2, Rho Kinase 2, Rho-associated, Coiled-coil-containing Protein Kinase 2, p164 ROCK-2, KIAA0619) (FITC)

Cat. Num. AAA6149401

• Gene Names: ROCK2; ROCK-II
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ROCK2; Monoclonal Antibody; ROCK2 (Rho-associated Protein Kinase 2; Rho Kinase 2; Rho-associated; Coiled-coil-containing Protein Kinase 2; p164 ROCK-2; KIAA0619) (FITC); anti-ROCK2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2A4
• Specificity: Recognizes human ROCK2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 8345

• Applicable Applications for anti-ROCK2 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1279-1388 from ROCK2 (NP_004841) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(ROCK2 monoclonal antibody Western Blot analysis of ROCK2 expression in HeLa)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ROCK2 on HeLa cell. [antibody concentration 10ug/ml)

Product Categories/Family for anti-ROCK2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 1519315777
• NCBI GeneID: 9475
• NCBI Accession #: NM_004850.5
• NCBI GenBank Nucleotide #: NM_004850
• UniProt Accession #: O75116
• NCBI Official Full Name: Homo sapiens Rho associated coiled-coil containing protein kinase 2 (ROCK2), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: Rho associated coiled-coil containing protein kinase 2
• NCBI Official Symbol: ROCK2
• NCBI Official Synonym Symbols: ROCK-II
• NCBI Protein Information: rho-associated protein kinase 2
• UniProt Protein Name: Rho-associated protein kinase 2
• Protein Family: Rho-associated protein kinase
• UniProt Gene Name: ROCK2
• UniProt Synonym Gene Names: KIAA0619; ROCK-II
• UniProt Entry Name: ROCK2_HUMAN

NCBI Description

The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho. [provided by RefSeq, Jul 2008]

Uniprot Description

ROCK2: Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus. Homodimer. Interacts with IRS1, RHOB and RHOC. Interacts with RHOA (activated by GTP), PPP1R12A, CHORDC1, SORL1, EP300 and BRCA2. Interacts with NPM1 and this interaction enhances its activity. Interacts with RAF1. Activated by RHOA binding. Inhibited by Y-27632. Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.

Protein type: Kinase, protein; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Protein kinase, AGC; AGC group; DMPK family; ROCK subfamily

Chromosomal Location of Human Ortholog: 2p24

Cellular Component: centrosome; plasma membrane; spindle pole centrosome; cytosol; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; Rho GTPase binding; metal ion binding; structural molecule activity; ATP binding

Biological Process: regulation of cell adhesion; axon guidance; dendrite morphogenesis; rhythmic process; cytokinesis; regulation of circadian rhythm; protein amino acid phosphorylation; Rho protein signal transduction; negative regulation of angiogenesis; smooth muscle contraction; induction of apoptosis via death domain receptors; regulation of stress fiber formation; regulation of actin cytoskeleton organization and biogenesis; neural tube closure; regulation of focal adhesion formation; ephrin receptor signaling pathway; vascular endothelial growth factor receptor signaling pathway; actin cytoskeleton organization and biogenesis; regulation of keratinocyte differentiation; centrosome duplication