Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GNL3Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GNL3 Polyclonal Antibody | anti-GNL3 antibody

GNL3 Antibody - C-terminal region

Gene Names
GNL3; NS; E2IG3; NNP47; C77032
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GNL3; Polyclonal Antibody; GNL3 Antibody - C-terminal region; anti-GNL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LFQSSGLTNGIIEEKDIHEELPKRKERKQEEREDDKDSDQETVDEEVDEN
Sequence Length
549
Applicable Applications for anti-GNL3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GNL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GNL3Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNL3Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GNL3 antibody
The protein encoded by this gene may interact with p53 and may be involved in tumorigenesis. The encoded protein also appears to be important for stem cell proliferation. This protein is found in both the nucleus and nucleolus. Three transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-GNL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62 kDa
NCBI Official Full Name
guanine nucleotide-binding protein-like 3 isoform 1
NCBI Official Synonym Full Names
G protein nucleolar 3
NCBI Official Symbol
GNL3
NCBI Official Synonym Symbols
NS; E2IG3; NNP47; C77032
NCBI Protein Information
guanine nucleotide-binding protein-like 3
UniProt Protein Name
Guanine nucleotide-binding protein-like 3
UniProt Gene Name
GNL3
UniProt Synonym Gene Names
E2IG3; NS
UniProt Entry Name
GNL3_HUMAN

NCBI Description

The protein encoded by this gene may interact with p53 and may be involved in tumorigenesis. The encoded protein also appears to be important for stem cell proliferation. This protein is found in both the nucleus and nucleolus. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

GNL3: May be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis. May interact with p53/TP53 via its basic domain. Increased levels in lung tissue in cancer patients. Belongs to the MMR1/HSR1 GTP-binding protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Cell cycle regulation; Nucleolus; RNA-binding

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: nucleoplasm; extracellular space; membrane; nucleolus; nucleus

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: cell proliferation; metabolic process; ribosome biogenesis and assembly; regulation of cell proliferation

Research Articles on GNL3

Similar Products

Product Notes

The GNL3 gnl3 (Catalog #AAA3223477) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNL3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNL3 gnl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFQSSGLTNG IIEEKDIHEE LPKRKERKQE EREDDKDSDQ ETVDEEVDEN. It is sometimes possible for the material contained within the vial of "GNL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.