Testing Data
(Detection limit for recombinant GST tagged RIT2 is ~0.3ng/ml as a capture antibody.)
Mouse anti-Human RIT2 Monoclonal Antibody | anti-RIT2 antibody
RIT2 (RIN, ROC2, GTP-binding Protein Rit2, Ras-like Protein Expressed in Neurons, Ras-like Without CAAX Protein 2) (Biotin)
Gene Names
RIT2; RIN; RIBA; ROC2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RIT2; Monoclonal Antibody; RIT2 (RIN; ROC2; GTP-binding Protein Rit2; Ras-like Protein Expressed in Neurons; Ras-like Without CAAX Protein 2) (Biotin); anti-RIT2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F2
Specificity
Recognizes human RIT2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RIT2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to human RIT2, aa1-218 (AAH18060) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLKKKRENMT
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged RIT2 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged RIT2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-RIT2 antibody
GTP-binding protein Rit2 (Rit2; also Rin, Ras-like protein expressed in neurons, Ras-like without CAAX) is a 25kD member of the small GTPase superfamily and Ras family. Human Rit2 is 217aa in length. Like all small G-proteins, Rit2 contains five highly conserved domains (G1-G5) and acts as a molecular switch by alternating an active GTP-bound form and an inactive GDP-bound form. There are two isoforms for Rit2. Isoform 1 is the long form. Isoform 2 has an 11aa substitution for residues 143-153 found in isoform 1 and a deletion of aa154-217. Rit2 is expressed exclusively in neurons. In addition, Rit2 binds calmodulin through a C-terminal binding motif.
Product Categories/Family for anti-RIT2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
17,308 Da
NCBI Official Full Name
Homo sapiens Ras-like without CAAX 2, mRNA
NCBI Official Synonym Full Names
Ras like without CAAX 2
NCBI Official Symbol
RIT2
NCBI Official Synonym Symbols
RIN; RIBA; ROC2
NCBI Protein Information
GTP-binding protein Rit2
Protein Family
NCBI Description
RIN belongs to the RAS (HRAS; MIM 190020) superfamily of small GTPases (Shao et al., 1999 [PubMed 10545207]).[supplied by OMIM, Mar 2008]
Research Articles on RIT2
Similar Products
Product Notes
The RIT2 (Catalog #AAA6144045) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RIT2 (RIN, ROC2, GTP-binding Protein Rit2, Ras-like Protein Expressed in Neurons, Ras-like Without CAAX Protein 2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RIT2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RIT2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RIT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
