Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged UPF1 is 0.1ng/ml as a capture antibody.)

Mouse anti-Human RENT1 Monoclonal Antibody | anti-UPF1 antibody

RENT1 (Regulator of Nonsense Transcripts 1, ATP-dependent Helicase RENT1, Nonsense mRNA Reducing Factor 1, NORF1, Up-frameshift Suppressor 1 Homolog, hUpf1, KIAA0221, UPF1, FLJ43809, FLJ46894)

Gene Names
UPF1; HUPF1; NORF1; RENT1; smg-2; pNORF1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RENT1; Monoclonal Antibody; RENT1 (Regulator of Nonsense Transcripts 1; ATP-dependent Helicase RENT1; Nonsense mRNA Reducing Factor 1; NORF1; Up-frameshift Suppressor 1 Homolog; hUpf1; KIAA0221; UPF1; FLJ43809; FLJ46894); Anti -RENT1 (Regulator of Nonsense Transcripts 1; anti-UPF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G3
Specificity
Recognizes human UPF1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLS
Applicable Applications for anti-UPF1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1019-1117, from human UPF1 (NP_002902) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged UPF1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UPF1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-UPF1 antibody
RENT1 is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping.
Product Categories/Family for anti-UPF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
124,345 Da
NCBI Official Full Name
regulator of nonsense transcripts 1
NCBI Official Synonym Full Names
UPF1 regulator of nonsense transcripts homolog (yeast)
NCBI Official Symbol
UPF1
NCBI Official Synonym Symbols
HUPF1; NORF1; RENT1; smg-2; pNORF1
NCBI Protein Information
regulator of nonsense transcripts 1; delta helicase; UP Frameshift 1; yeast Upf1p homolog; ATP-dependent helicase RENT1; nonsense mRNA reducing factor 1; up-frameshift mutation 1 homolog; up-frameshift suppressor 1 homolog; smg-2 homolog, nonsense mediated mRNA decay factor
UniProt Protein Name
Regulator of nonsense transcripts 1
UniProt Gene Name
UPF1
UniProt Synonym Gene Names
KIAA0221; RENT1; NORF1; hUpf1
UniProt Entry Name
RENT1_HUMAN

NCBI Description

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: RNA-dependent helicase and ATPase required for nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation; its phosphorylation appears to be a key step in NMD. Recruited by release factors to stalled ribosomes together with the SMG1C protein kinase complex to form the transient SURF (SMG1-UPF1-eRF1-eRF3) complex. In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) (located 50-55 or more nucleotides downstream from the termination codon) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD. Phosphorylated UPF1 is recognized by EST1B/SMG5, SMG6 and SMG7 which are thought to provide a link to the mRNA degradation machinery involving exonucleolytic and endonucleolytic pathways, and to serve as adapters to protein phosphatase 2A (PP2A), thereby triggering UPF1 dephosphorylation and allowing the recycling of NMD factors. UPF1 can also activate NMD without UPF2 or UPF3, and in the absence of the NMD-enhancing downstream EJC indicative for alternative NMD pathways. Plays a role in replication-dependent histone mRNA degradation at the end of phase S; the function is independent of UPF2. For the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. The ATPase activity of UPF1 is required for disassembly of mRNPs undergoing NMD. Essential for embryonic viability. Ref.7 Ref.17 Ref.22 Ref.30 Ref.36

Subunit structure: Found in a post-splicing messenger ribonucleoprotein (mRNP) complex. Associates with the exon junction complex (EJC). Associates with the SGM1C complex; is phosphorylated by the complex kinase component SGM1. Interacts with UPF2, UPF3A and UPF3B. Interacts with EST1A and SLBP. Interacts (when hyperphosphorylated) with PNRC2. Interacts with AGO1, AGO2 and GSPT2. Interacts with isoform 1 and isoform 5 of ADAR/ADAR1. Ref.7 Ref.8 Ref.12 Ref.13 Ref.15 Ref.16 Ref.17 Ref.19 Ref.20 Ref.23 Ref.25 Ref.28

Subcellular location: Cytoplasm. Cytoplasm › P-body. Nucleus. Note: Hyperphosphorylated form is targeted to the P-body, while unphosphorylated protein is distributed throughout the cytoplasm. Ref.7 Ref.12 Ref.25 Ref.28

Tissue specificity: Ubiquitous.

Domain: The [ST]-Q motif constitutes a recognition sequence for kinases from the PI3/PI4-kinase family.

Post-translational modification: Phosphorylated by SMG1; required for formation of mRNA surveillance complexes. Ref.10 Ref.11 Ref.14 Ref.19 Ref.28

Sequence similarities: Belongs to the DNA2/NAM7 helicase family.Contains 1 UPF1-type zinc finger.

Sequence caution: The sequence BAA19664.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on UPF1

Similar Products

Product Notes

The UPF1 upf1 (Catalog #AAA646065) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RENT1 (Regulator of Nonsense Transcripts 1, ATP-dependent Helicase RENT1, Nonsense mRNA Reducing Factor 1, NORF1, Up-frameshift Suppressor 1 Homolog, hUpf1, KIAA0221, UPF1, FLJ43809, FLJ46894) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RENT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the UPF1 upf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GRQKNRFGLP GPSQTNLPNS QASQDVASQP FSQGALTQGY ISMSQPSQMS QPGLSQPELS QDSYLGDEFK SQIDVALSQD STYQGERAYQ HGGVTGLS. It is sometimes possible for the material contained within the vial of "RENT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.