RENT1/hUPF1 Polyclonal Antibody | anti-RENT1/hUPF1 antibody

Anti-RENT1/hUPF1 Antibody

Cat. Num. AAA177828

• Gene Names: UPF1; HUPF1; NORF1; RENT1; smg-2; pNORF1
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: RENT1/hUPF1; Polyclonal Antibody; Anti-RENT1/hUPF1 Antibody; Regulator of nonsense transcripts 1; ATP dependent helicase RENT1; ATP-dependent helicase RENT1; Delta helicase; FLJ43809; FLJ46894; HUPF 1; hUpf1; KIAA0221; Nonsense mRNA reducing factor 1; NORF 1; NORF1; pNORF 1; pNORF1; RENT 1; RENT1; RENT1_HUMAN; Smg 2; Smg 2 homolog nonsense mediated mRNA decay factor; UP Frameshift 1; Up frameshift mutation 1 homolog (S. cerevisiae); Up frameshift mutation 1 homolog; Up frameshift suppressor 1 homolog; Up-frameshift suppressor 1 homolog; UPF 1; UPF 1 regulator of nonsense transcripts homolog; upf1; UPF1 regulator of nonsense transcripts homolog; Yeast Upf1p homolog; UPF1 regulator of nonsense transcripts homolog (yeast); anti-RENT1/hUPF1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 1129

• Applicable Applications for anti-RENT1/hUPF1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- RENT1/hUPF1 Picoband antibody, MBS177828, Western blottingAll lanes: Anti RENT1/hUPF1 (MBS177828) at 0.5ug/mlLane 1: Rat Pancreas Tissue Lysate at 50ugLane 2: PANC Whole Cell Lysate at 40ugPredicted bind size: 140KDObserved bind size: 140KD )

Immunohistochemistry (IHC)

(Anti- RENT1/hUPF1 Picoband antibody, MBS177828, IHC(P)IHC(P): Mouse Intestine Tissue)

Immunohistochemistry (IHC)

(Anti- RENT1/hUPF1 Picoband antibody, MBS177828, IHC(P)IHC(P): Rat Intestine Tissue)

Immunohistochemistry (IHC)

(Anti- RENT1/hUPF1 Picoband antibody, MBS177828, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

Related Product Information for anti-RENT1/hUPF1 antibody

Description: Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 1(UPF1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.

References

1. "Entrez Gene: UPF1 UPF1 regulator of nonsense transcripts homolog (yeast)". 2. Applequist SE, Selg M, Raman C, Jack HM (March 1997). "Cloning and characterization of HUPF1, a human homolog of the Saccharomyces cerevisiae nonsense mRNA-reducing UPF1 protein". Nucleic Acids Res 25 (4): 814-21. 3. Perlick HA, Medghalchi SM, Spencer FA, Kendzior RJ Jr, Dietz HC (November 1996). "Mammalian orthologues of a yeast regulator of nonsense transcript stability". Proc Natl Acad Sci U S A 93 (20): 10928-32.

NCBI and Uniprot Product Information

• NCBI GI #: 662033888
• NCBI GeneID: 5976
• NCBI Accession #: NP_001284478.1
• NCBI GenBank Nucleotide #: NM_001297549.1
• UniProt Accession #: Q92900; O00239; O43343; Q86Z25; Q92842
• Molecular Weight: 123,036 Da
• NCBI Official Full Name: regulator of nonsense transcripts 1 isoform 1
• NCBI Official Synonym Full Names: UPF1, RNA helicase and ATPase
• NCBI Official Symbol: UPF1
• NCBI Official Synonym Symbols: HUPF1; NORF1; RENT1; smg-2; pNORF1
• NCBI Protein Information: regulator of nonsense transcripts 1
• UniProt Protein Name: Regulator of nonsense transcripts 1
• UniProt Gene Name: UPF1
• UniProt Synonym Gene Names: KIAA0221; RENT1; NORF1; hUpf1
• UniProt Entry Name: RENT1_HUMAN

NCBI Description

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

RNA-dependent helicase and ATPase required for nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation; its phosphorylation appears to be a key step in NMD. Recruited by release factors to stalled ribosomes together with the SMG1C protein kinase complex to form the transient SURF (SMG1-UPF1-eRF1-eRF3) complex. In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) (located 50-55 or more nucleotides downstream from the termination codon) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD. Phosphorylated UPF1 is recognized by EST1B/SMG5, SMG6 and SMG7 which are thought to provide a link to the mRNA degradation machinery involving exonucleolytic and endonucleolytic pathways, and to serve as adapters to protein phosphatase 2A (PP2A), thereby triggering UPF1 dephosphorylation and allowing the recycling of NMD factors. UPF1 can also activate NMD without UPF2 or UPF3, and in the absence of the NMD-enhancing downstream EJC indicative for alternative NMD pathways. Plays a role in replication-dependent histone mRNA degradation at the end of phase S; the function is independent of UPF2. For the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. The ATPase activity of UPF1 is required for disassembly of mRNPs undergoing NMD. Essential for embryonic viability.