Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RELA monoclonal antibody, Western Blot analysis of RELA expression in HeLa NE.)

Mouse anti-Human RELA Monoclonal Antibody | anti-RELA antibody

RELA (Transcription Factor p65, Nuclear Factor NF-kappa-B p65 Subunit, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 3, NFKB3, MGC131774) (PE)

Gene Names
RELA; p65; CMCU; NFKB3
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RELA; Monoclonal Antibody; RELA (Transcription Factor p65; Nuclear Factor NF-kappa-B p65 Subunit; Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 3; NFKB3; MGC131774) (PE); anti-RELA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1, lambda
Clone Number
8G3
Specificity
Recognizes human RELA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RELA antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 35ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa432-506, from human RELA (NP_068810) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RELA monoclonal antibody, Western Blot analysis of RELA expression in HeLa NE.)

Western Blot (WB) (RELA monoclonal antibody, Western Blot analysis of RELA expression in HeLa NE.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RELA on HeLa cell. [antibody concentration 35ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RELA on HeLa cell. [antibody concentration 35ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RELA is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RELA is 0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between IKBKB and RELA. HeLa cells were stained with IKBKB rabbit purified polyclonal 1:1200 and RELA mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between IKBKB and RELA. HeLa cells were stained with IKBKB rabbit purified polyclonal 1:1200 and RELA mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-RELA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
transcription factor p65 isoform 1
NCBI Official Synonym Full Names
RELA proto-oncogene, NF-kB subunit
NCBI Official Symbol
RELA
NCBI Official Synonym Symbols
p65; CMCU; NFKB3
NCBI Protein Information
transcription factor p65
UniProt Protein Name
Transcription factor p65
Protein Family
UniProt Gene Name
RELA
UniProt Synonym Gene Names
NFKB3
UniProt Entry Name
TF65_HUMAN

NCBI Description

NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

NFkB-p65: a subunit of NF-kappa-B transcription complex, which plays a crucial role in inflammatory and immune responses. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. P65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. There are five NFkB proteins in mammals (RelA/NFkB-p65, RelB, c-Rel, NF-_B1/NFkB-p105, and NF-_B2/NFkB-p100). They form a variety of homodimers and heterodimers, each of which activates its own characteristic set of genes. Three splice-variant isoforms have been identified.

Protein type: Transcription factor; Nuclear receptor co-regulator; DNA-binding

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; cytosol; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; identical protein binding; NF-kappaB binding; protein binding; transcription activator binding; DNA binding; protein heterodimerization activity; ubiquitin protein ligase binding; protein complex binding; protein N-terminus binding; chromatin binding; phosphate binding; transcription factor activity; protein kinase binding; transcription factor binding

Biological Process: viral reproduction; nerve growth factor receptor signaling pathway; positive regulation of transcription, DNA-dependent; negative regulation of insulin receptor signaling pathway; toll-like receptor 3 signaling pathway; T cell receptor signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 5 signaling pathway; hair follicle development; toll-like receptor 4 signaling pathway; defense response to virus; response to drug; membrane protein intracellular domain proteolysis; positive regulation of I-kappaB kinase/NF-kappaB cascade; acetaldehyde metabolic process; response to amino acid stimulus; toll-like receptor 2 signaling pathway; organ morphogenesis; positive regulation of chondrocyte differentiation; response to muramyl dipeptide; response to mechanical stimulus; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; negative regulation of transcription, DNA-dependent; response to progesterone stimulus; negative regulation of protein catabolic process; negative regulation of apoptosis; transcription from RNA polymerase II promoter; response to cAMP; response to morphine; negative regulation of transcription from RNA polymerase II promoter; toll-like receptor 10 signaling pathway; response to insulin stimulus; response to organic substance; positive regulation of cell proliferation; positive regulation of interferon type I production; inflammatory response; aging; positive regulation of Schwann cell differentiation; MyD88-independent toll-like receptor signaling pathway; cytokine and chemokine mediated signaling pathway; liver development; response to UV-B; MyD88-dependent toll-like receptor signaling pathway; positive regulation of interleukin-12 biosynthetic process; regulation of inflammatory response; toll-like receptor signaling pathway; cellular defense response; innate immune response; response to cobalamin

Research Articles on RELA

Similar Products

Product Notes

The RELA rela (Catalog #AAA6159896) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RELA (Transcription Factor p65, Nuclear Factor NF-kappa-B p65 Subunit, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 3, NFKB3, MGC131774) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RELA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 35ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RELA rela for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RELA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.