Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD) usingMBS6002137.)

Mouse anti-Human RBMXL2 Monoclonal Antibody | anti-RBMXL2 antibody

RBMXL2 (RNA-binding Motif Protein, X-linked-like-2, Testis-specific Heterogeneous Nuclear Ribonucleoprotein G-T, hnRNP G-T, HNRNPGT) (MaxLight 750)

Gene Names
RBMXL2; HNRPGT; HNRNPGT; HNRNPG-T
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RBMXL2; Monoclonal Antibody; RBMXL2 (RNA-binding Motif Protein; X-linked-like-2; Testis-specific Heterogeneous Nuclear Ribonucleoprotein G-T; hnRNP G-T; HNRNPGT) (MaxLight 750); anti-RBMXL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6F11
Specificity
Recognizes human RBMXL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-RBMXL2 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-90 from human RBMXL2 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMNGKSLDGKAIKVAQATKPAFE*
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD) usingMBS6002137.)

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD) usingMBS6002137.)

Western Blot (WB)

(Western Blot analysis of HNRNPG-T expression in HeLa usingMBS6002137.)

Western Blot (WB) (Western Blot analysis of HNRNPG-T expression in HeLa usingMBS6002137.)
Related Product Information for anti-RBMXL2 antibody
MaxLight750 is a new Near IR stable dye conjugate comparable to DyLight750, Alexa Fluor700 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000.
Product Categories/Family for anti-RBMXL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
RNA-binding motif protein, X-linked-like-2
NCBI Official Synonym Full Names
RBMX like 2
NCBI Official Symbol
RBMXL2
NCBI Official Synonym Symbols
HNRPGT; HNRNPGT; HNRNPG-T
NCBI Protein Information
RNA-binding motif protein, X-linked-like-2
UniProt Protein Name
RNA-binding motif protein, X-linked-like-2
Protein Family
UniProt Gene Name
RBMXL2
UniProt Synonym Gene Names
HNRNPGT; hnRNP G-T
UniProt Entry Name
RMXL2_HUMAN

NCBI Description

This gene belongs to the HNRPG subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two RRM domains that bind RNAs. This gene is intronless and is thought to be derived from a processed retroposon. However, unlike many retroposon-derived genes, this gene is not a pseudogene. The encoded protein has similarity to HNRPG and RBMY proteins and it is suggested to replace HNRPG protein function during meiotic prophase or act as a germ cell-specific splicing regulator. It primarily localizes to the nuclei of meiotic spermatocytes. This gene is a candidate for autosomal male infertility. [provided by RefSeq, Jul 2008]

Research Articles on RBMXL2

Similar Products

Product Notes

The RBMXL2 rbmxl2 (Catalog #AAA6233271) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBMXL2 (RNA-binding Motif Protein, X-linked-like-2, Testis-specific Heterogeneous Nuclear Ribonucleoprotein G-T, hnRNP G-T, HNRNPGT) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBMXL2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBMXL2 rbmxl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBMXL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.