Mouse RBM15 Monoclonal Antibody | anti-RBM15 antibody

RBM15 (RNA Binding Motif Protein 15, FLJ12479, FLJ21943, MGC119584, OTT, OTT1, SPEN) (Biotin)

Cat. Num. AAA6173578

• Applications: ELISA
• Purity: Purified
• Synonyms: RBM15; Monoclonal Antibody; RBM15 (RNA Binding Motif Protein 15; FLJ12479; FLJ21943; MGC119584; OTT; OTT1; SPEN) (Biotin); RNA Binding Motif Protein 15; SPEN; anti-RBM15 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C1
• Specificity: Recognizes RBM15.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 977

• Applicable Applications for anti-RBM15 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RBM15 (NP_073605.4, 701aa-810aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDL
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RBM15 is 0.1 ng/ml as a capture antibody.)

Related Product Information for anti-RBM15 antibody

Members of the SPEN (Split-end) family of proteins, including RBM15, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]). [supplied by OMIM]

Product Categories/Family for anti-RBM15 antibody

Antibodies; RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 47933339
• NCBI Accession #: NP_073605.4
• NCBI GenBank Nucleotide #: NP_073605.4
• UniProt Accession #: Q96T37
• NCBI Official Full Name: RNA-binding protein 15 isoform 1
• UniProt Protein Name: Putative RNA-binding protein 15
• Protein Family: Putative RNA-binding protein
• UniProt Gene Name: RBM15
• UniProt Synonym Gene Names: OTT; OTT1
• UniProt Entry Name: RBM15_HUMAN

Uniprot Description

RBM15: May be implicated in HOX gene regulation. A chromosomal aberration involving RBM15 may be a cause of acute megakaryoblastic leukemia. Translocation t(1;22)(p13;q13) with MKL1. Although both reciprocal fusion transcripts are detected in acute megakaryoblastic leukemia (AMKL, FAB-M7), the RBM15-MKL1 chimeric protein has all the putative functional domains encoded by each gene and is the candidate oncogene. Belongs to the RRM Spen family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Spliceosome; Oncoprotein; RNA-binding

Chromosomal Location of Human Ortholog: 1p13

Cellular Component: nucleoplasm; nuclear membrane

Molecular Function: protein binding; nucleotide binding

Biological Process: spleen development; patterning of blood vessels; negative regulation of myeloid cell differentiation; viral reproduction; negative regulation of transcription, DNA-dependent; activation of Notch receptor target transcription factor