Mouse anti-Human DHX8 Monoclonal Antibody | anti-DHX8 antibody

DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8, DEAH Box Protein 8, DHX-8, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 8, DDX8, DDX-8, HRH1, Human RNA Helicase 1, PRP22, PRPF22) (FITC)

Cat. Num. AAA6146841

• Gene Names: DHX8; DDX8; Dhr2; HRH1; PRP22; PRPF22
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DHX8; Monoclonal Antibody; DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8; DEAH Box Protein 8; DHX-8; DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 8; DDX8; DDX-8; HRH1; Human RNA Helicase 1; PRP22; PRPF22) (FITC); anti-DHX8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1E10
• Specificity: Recognizes human DHX8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-DHX8 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa301-400 from human DHX8 (NP_004932) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(DHX8 monoclonal antibody Western Blot analysis of DHX8 expression in Hela NE.)

Testing Data

(Detection limit for recombinant GST tagged DHX8 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-DHX8 antibody

Antibodies; DEAD Box Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4826690
• NCBI GeneID: 1659
• NCBI Accession #: NP_004932
• NCBI GenBank Nucleotide #: NM_004941
• UniProt Accession #: Q14562
• Molecular Weight: 139kDa
• NCBI Official Full Name: ATP-dependent RNA helicase DHX8 isoform 1
• NCBI Official Synonym Full Names: DEAH-box helicase 8
• NCBI Official Symbol: DHX8
• NCBI Official Synonym Symbols: DDX8; Dhr2; HRH1; PRP22; PRPF22
• NCBI Protein Information: ATP-dependent RNA helicase DHX8
• UniProt Protein Name: ATP-dependent RNA helicase DHX8
• Protein Family: ATP-dependent RNA helicase
• UniProt Gene Name: DHX8
• UniProt Synonym Gene Names: DDX8
• UniProt Entry Name: DHX8_HUMAN

NCBI Description

This gene is a member of the DEAH box polypeptide family. The encoded protein contains the DEAH (Asp-Glu-Ala-His) motif which is characteristic of all DEAH box proteins, and is thought to function as an ATP-dependent RNA helicase that regulates the release of spliced mRNAs from spliceosomes prior to their export from the nucleus. This protein may be required for the replication of human immunodeficiency virus type 1 (HIV-1). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Uniprot Description

DDX8: Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. Belongs to the DEAD box helicase family. DEAH subfamily. DDX8/PRP22 sub-subfamily.

Protein type: RNA-binding; RNA processing; RNA splicing; EC 3.6.4.13; Helicase; Spliceosome

Chromosomal Location of Human Ortholog: 17q21.31

Cellular Component: nucleoplasm; spliceosome; cytoplasm; nucleus

Molecular Function: identical protein binding; protein binding; ATP binding; ATP-dependent RNA helicase activity

Biological Process: RNA processing; nuclear mRNA splicing, via spliceosome; RNA splicing