Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RBM15 is 0.1 ng/ml as a capture antibody.)

Mouse RBM15 Monoclonal Antibody | anti-RBM15 antibody

RBM15 (RNA Binding Motif Protein 15, FLJ12479, FLJ21943, MGC119584, OTT, OTT1, SPEN) (APC)

Applications
ELISA
Purity
Purified
Synonyms
RBM15; Monoclonal Antibody; RBM15 (RNA Binding Motif Protein 15; FLJ12479; FLJ21943; MGC119584; OTT; OTT1; SPEN) (APC); RNA Binding Motif Protein 15; SPEN; anti-RBM15 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C1
Specificity
Recognizes RBM15.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
977
Applicable Applications for anti-RBM15 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RBM15 (NP_073605.4, 701aa-810aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RBM15 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RBM15 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-RBM15 antibody
Members of the SPEN (Split-end) family of proteins, including RBM15, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]). [supplied by OMIM]
Product Categories/Family for anti-RBM15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
RNA-binding protein 15 isoform 1
UniProt Protein Name
Putative RNA-binding protein 15
UniProt Gene Name
RBM15
UniProt Synonym Gene Names
OTT; OTT1
UniProt Entry Name
RBM15_HUMAN

Uniprot Description

RBM15: May be implicated in HOX gene regulation. A chromosomal aberration involving RBM15 may be a cause of acute megakaryoblastic leukemia. Translocation t(1;22)(p13;q13) with MKL1. Although both reciprocal fusion transcripts are detected in acute megakaryoblastic leukemia (AMKL, FAB-M7), the RBM15-MKL1 chimeric protein has all the putative functional domains encoded by each gene and is the candidate oncogene. Belongs to the RRM Spen family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Spliceosome; Oncoprotein; RNA-binding

Chromosomal Location of Human Ortholog: 1p13

Cellular Component: nucleoplasm; nuclear membrane

Molecular Function: protein binding; nucleotide binding

Biological Process: spleen development; patterning of blood vessels; negative regulation of myeloid cell differentiation; viral reproduction; negative regulation of transcription, DNA-dependent; activation of Notch receptor target transcription factor

Similar Products

Product Notes

The RBM15 rbm15 (Catalog #AAA6169168) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RBM15 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBM15 rbm15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBM15, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.