Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RASGRP3 is 0.1ng/ml as a capture antibody.)

Mouse anti-Human RASGRP3 Monoclonal Antibody | anti-RASGRP3 antibody

RASGRP3 (Ras Guanyl-releasing Protein 3, Calcium and DAG-regulated Guanine Nucleotide Exchange Factor III, GRP3, Guanine Nucleotide Exchange Factor for Rap1, KIAA0846)

Gene Names
RASGRP3; GRP3
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RASGRP3; Monoclonal Antibody; RASGRP3 (Ras Guanyl-releasing Protein 3; Calcium and DAG-regulated Guanine Nucleotide Exchange Factor III; GRP3; Guanine Nucleotide Exchange Factor for Rap1; KIAA0846); Anti -RASGRP3 (Ras Guanyl-releasing Protein 3; anti-RASGRP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H4
Specificity
Recognizes human RASGRP3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMT*
Applicable Applications for anti-RASGRP3 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa1-99 from RASGRP3 (NP_733772) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RASGRP3 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RASGRP3 is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-RASGRP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,332 Da
NCBI Official Full Name
ras guanyl-releasing protein 3 isoform 1
NCBI Official Synonym Full Names
RAS guanyl releasing protein 3 (calcium and DAG-regulated)
NCBI Official Symbol
RASGRP3
NCBI Official Synonym Symbols
GRP3
NCBI Protein Information
ras guanyl-releasing protein 3; guanine nucleotide exchange factor for Rap1; calcium and DAG-regulated guanine nucleotide exchange factor III
UniProt Protein Name
Ras guanyl-releasing protein 3
UniProt Gene Name
RASGRP3
UniProt Synonym Gene Names
GRP3; KIAA0846
UniProt Entry Name
GRP3_HUMAN

NCBI Description

Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RASGRP3, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM, Mar 2008]

Uniprot Description

Function: Guanine nucleotide exchange factor (GEF) for Ras and Rap1. Ref.6

Sequence similarities: Belongs to the RASGRP family.Contains 2 EF-hand domains.Contains 1 N-terminal Ras-GEF domain.Contains 1 phorbol-ester/DAG-type zinc finger.Contains 1 Ras-GEF domain.

Sequence caution: The sequence BAA74869.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on RASGRP3

Similar Products

Product Notes

The RASGRP3 rasgrp3 (Catalog #AAA649669) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RASGRP3 (Ras Guanyl-releasing Protein 3, Calcium and DAG-regulated Guanine Nucleotide Exchange Factor III, GRP3, Guanine Nucleotide Exchange Factor for Rap1, KIAA0846) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RASGRP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the RASGRP3 rasgrp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGSSGLGKAA TLDELLCTCI EMFDDNGELD NSYLPRIVLL MHRWYLSSTE LAEKLLCMYR NATGESCNEF RLKICYFMRY WILKFPAEFN LDLGLIRMT*. It is sometimes possible for the material contained within the vial of "RASGRP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.