Mouse anti-Human RAPGEF1 Monoclonal Antibody | anti-RAPGEF1 antibody

RAPGEF1 (Rap Guanine Nucleotide Exchange Factor 1, CRK SH3-binding GNRP, Guanine Nucleotide-releasing Factor 2, Protein C3G, GRF2) (AP)

Cat. Num. AAA6133313

• Gene Names: RAPGEF1; C3G; GRF2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAPGEF1; Monoclonal Antibody; RAPGEF1 (Rap Guanine Nucleotide Exchange Factor 1; CRK SH3-binding GNRP; Guanine Nucleotide-releasing Factor 2; Protein C3G; GRF2) (AP); anti-RAPGEF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D10
• Specificity: Recognizes human RAPGEF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 6060

• Applicable Applications for anti-RAPGEF1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-110 from human RAPGEF1 (AAH41710) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGNAIEKQKPLKRSHLYPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSW
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(Western Blot analysis of RAPGEF1 expression in transfected 293T cell line by RAPGEF1 monoclonal antibody. Lane 1: RAPGEF1 transfected lysate (122.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RAPGEF1 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-RAPGEF1 antibody

Guanine nucleotide-releasing protein that binds to SH3 domain of CRK and GRB2/ASH. Transduces signals from CRK to activate RAS.

Product Categories/Family for anti-RAPGEF1 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

References

1. The WAVE2 complex regulates T cell receptor signaling to integrins via Abl- and CrkL-C3G-mediated activation of Rap1. Nolz JC, Nacusi LP, Segovis CM, Medeiros RB, Mitchell JS, Shimizu Y, Billadeau DD.J Cell Biol. 2008 Sep 22;182(6):1231-44.

NCBI and Uniprot Product Information

• NCBI GI #: 27469838
• NCBI GeneID: 2889
• NCBI Official Full Name: Homo sapiens Rap guanine nucleotide exchange factor (GEF) 1, mRNA
• NCBI Official Synonym Full Names: Rap guanine nucleotide exchange factor 1
• NCBI Official Symbol: RAPGEF1
• NCBI Official Synonym Symbols: C3G; GRF2
• NCBI Protein Information: rap guanine nucleotide exchange factor 1
• Protein Family: Rap guanine nucleotide exchange factor

NCBI Description

This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]