Mouse anti-Human, Rat RAD18 Monoclonal Antibody | anti-RAD18 antibody

RAD18 (E3 Ubiquitin-protein Ligase RAD18, Postreplication Repair Protein RAD18, hRAD18, hHR18, RING Finger Protein 73, RNF73) (Biotin)

Cat. Num. AAA6143898

• Gene Names: RAD18; RNF73
• Reactivity: Human, Rat
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAD18; Monoclonal Antibody; RAD18 (E3 Ubiquitin-protein Ligase RAD18; Postreplication Repair Protein RAD18; hRAD18; hHR18; RING Finger Protein 73; RNF73) (Biotin); EC=6.3.2.-; anti-RAD18 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3H7
• Specificity: Recognizes human RAD18. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-RAD18 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 25ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa332-431 from human RAD18 (NP_064550) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of RAD18 expression in transfected 293T cell line by RAD18 monoclonal antibody. Lane 1: RAD18 transfected lysate (56.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RAD18 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 25ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged RAD18 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RAD18 over-expressed 293 cell line, cotransfected with RAD18 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD18 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(RAD18 monoclonal antibody, Western Blot analysis of RAD18 expression in Hela NE.)

Product Categories/Family for anti-RAD18 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 256818821
• NCBI GeneID: 56852
• NCBI Accession #: NP_064550
• NCBI GenBank Nucleotide #: NM_020165
• UniProt Accession #: Q9NS91
• Molecular Weight: 56kDa
• NCBI Official Full Name: E3 ubiquitin-protein ligase RAD18
• NCBI Official Synonym Full Names: RAD18 E3 ubiquitin protein ligase
• NCBI Official Symbol: RAD18
• NCBI Official Synonym Symbols: RNF73
• NCBI Protein Information: E3 ubiquitin-protein ligase RAD18
• UniProt Protein Name: E3 ubiquitin-protein ligase RAD18
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: RAD18
• UniProt Synonym Gene Names: RNF73; hHR18; hRAD18
• UniProt Entry Name: RAD18_HUMAN

NCBI Description

The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens. [provided by RefSeq, Jul 2008]

Uniprot Description

RAD18: a structural maintenance of chromosomes (SMC) protein involved in postreplication repair of UV-damaged DNA. Has ssDNA binding activity. Interacts with Rad6 through a conserved ring-finger motif. Rad6 is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA.

Protein type: Ubiquitin conjugating system; EC 6.3.2.-; Ubiquitin ligase; DNA repair, damage; EC 6.3.2.19; Ligase

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: XY body; replication fork; nucleus; chromatin

Molecular Function: Y-form DNA binding; protein binding; zinc ion binding; ubiquitin protein ligase binding; damaged DNA binding; polyubiquitin binding; ligase activity

Biological Process: negative regulation of DNA recombination; protein ubiquitination; spermatogenesis; DNA repair; response to UV