Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in Hela S3 NE.)

Mouse RAD18 Monoclonal Antibody | anti-RAD18 antibody

RAD18 (RAD18 Homolog (S. cerevisiae), RNF73) (AP)

Gene Names
RAD18; RNF73
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
RAD18; Monoclonal Antibody; RAD18 (RAD18 Homolog (S. cerevisiae); RNF73) (AP); RAD18 Homolog (S. cerevisiae); RNF73; anti-RAD18 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B9
Specificity
Recognizes RAD18.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RAD18 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RAD18 (NP_064550, 332aa-430aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in Hela S3 NE.)

Western Blot (WB) (RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in Hela S3 NE.)

Western Blot (WB)

(RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in PC-12.)

Western Blot (WB) (RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in PC-12.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-RAD18 antibody
The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens. [provided by RefSeq]
Product Categories/Family for anti-RAD18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RAD18
NCBI Official Synonym Full Names
RAD18 E3 ubiquitin protein ligase
NCBI Official Symbol
RAD18
NCBI Official Synonym Symbols
RNF73
NCBI Protein Information
E3 ubiquitin-protein ligase RAD18
UniProt Protein Name
E3 ubiquitin-protein ligase RAD18
UniProt Gene Name
RAD18
UniProt Synonym Gene Names
RNF73; hHR18; hRAD18
UniProt Entry Name
RAD18_HUMAN

NCBI Description

The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens. [provided by RefSeq, Jul 2008]

Uniprot Description

RAD18: a structural maintenance of chromosomes (SMC) protein involved in postreplication repair of UV-damaged DNA. Has ssDNA binding activity. Interacts with Rad6 through a conserved ring-finger motif. Rad6 is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA.

Protein type: Ubiquitin conjugating system; EC 6.3.2.-; Ubiquitin ligase; DNA repair, damage; EC 6.3.2.19; Ligase

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: XY body; replication fork; nucleus; chromatin

Molecular Function: Y-form DNA binding; protein binding; zinc ion binding; ubiquitin protein ligase binding; damaged DNA binding; polyubiquitin binding; ligase activity

Biological Process: negative regulation of DNA recombination; protein ubiquitination; spermatogenesis; DNA repair; response to UV

Research Articles on RAD18

Similar Products

Product Notes

The RAD18 rad18 (Catalog #AAA6163927) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RAD18 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAD18 rad18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAD18, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.