Mouse anti-Human QPCT Monoclonal Antibody | anti-Qpct antibody

QPCT (Glutaminyl-peptide Cyclotransferase, Glutaminyl Cyclase, Glutaminyl-tRNA Cyclotransferase, Glutamyl Cyclase)

Cat. Num. AAA6003746

• Gene Names: Qpct; 5730422A13Rik
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: QPCT; Monoclonal Antibody; QPCT (Glutaminyl-peptide Cyclotransferase; Glutaminyl Cyclase; Glutaminyl-tRNA Cyclotransferase; Glutamyl Cyclase); Anti -QPCT (Glutaminyl-peptide Cyclotransferase; anti-Qpct antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4E11
• Specificity: Recognizes human QPCT.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: PNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYL*

• Applicable Applications for anti-Qpct antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa262-360 from QPCT (NP_036545) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Testing Data

(Detection limit for recombinant GST tagged QPCT is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-Qpct antibody

This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase.

Product Categories/Family for anti-Qpct antibody

Antibodies; Abs to Enzymes; Cyclase

NCBI and Uniprot Product Information

• NCBI GI #: 18043218
• NCBI GeneID: 70536
• UniProt Accession #: Q9CYK2; Q8BH20; Q8VE07
• Molecular Weight: 41,119 Da
• NCBI Official Full Name: Qpct protein
• NCBI Official Synonym Full Names: glutaminyl-peptide cyclotransferase (glutaminyl cyclase)
• NCBI Official Symbol: Qpct
• NCBI Official Synonym Symbols: 5730422A13Rik
• NCBI Protein Information: glutaminyl-peptide cyclotransferase; QC; glutaminyl cyclase; glutaminyl-tRNA cyclotransferase
• UniProt Protein Name: Glutaminyl-peptide cyclotransferase
• UniProt Gene Name: Qpct
• UniProt Synonym Gene Names: QC
• UniProt Entry Name: QPCT_MOUSE

Uniprot Description

QPCT: Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides. Belongs to the glutaminyl-peptide cyclotransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; Secreted, signal peptide; EC 2.3.2.5; Secreted

Cellular Component: extracellular region

Molecular Function: transferase activity; glutaminyl-peptide cyclotransferase activity; zinc ion binding; metal ion binding; transferase activity, transferring acyl groups

Biological Process: peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase