Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to QPCT on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml])

Mouse QPCT Monoclonal Antibody | anti-QPCT antibody

QPCT (glutaminyl-peptide cyclotransferase, GCT, QC) (PE)

Gene Names
QPCT; QC; GCT; sQC
Applications
Immunohistochemistry
Purity
Purified
Synonyms
QPCT; Monoclonal Antibody; QPCT (glutaminyl-peptide cyclotransferase; GCT; QC) (PE); glutaminyl-peptide cyclotransferase; QC; anti-QPCT antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G2
Specificity
Recognizes QPCT.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-QPCT antibody
Immunohistochemistry (IHC)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
QPCT (NP_036545, 262aa-359aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to QPCT on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to QPCT on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to QPCT on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to QPCT on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged QPCT is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged QPCT is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-QPCT antibody
This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided by RefSeq]
Product Categories/Family for anti-QPCT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.7kDa (339aa) 28-40kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
glutaminyl-peptide cyclotransferase
NCBI Official Synonym Full Names
glutaminyl-peptide cyclotransferase
NCBI Official Symbol
QPCT
NCBI Official Synonym Symbols
QC; GCT; sQC
NCBI Protein Information
glutaminyl-peptide cyclotransferase
UniProt Protein Name
Glutaminyl-peptide cyclotransferase
UniProt Gene Name
QPCT
UniProt Synonym Gene Names
QC; sQC; EC
UniProt Entry Name
QPCT_HUMAN

NCBI Description

This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided by RefSeq, Jul 2008]

Uniprot Description

QPCT: Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides. Belongs to the glutaminyl-peptide cyclotransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.3.2.5; Secreted; Secreted, signal peptide; Transferase

Chromosomal Location of Human Ortholog: 2p22.2

Molecular Function: glutaminyl-peptide cyclotransferase activity; zinc ion binding

Biological Process: peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase; protein modification process

Research Articles on QPCT

Similar Products

Product Notes

The QPCT qpct (Catalog #AAA6186041) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's QPCT can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the QPCT qpct for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "QPCT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.