Rabbit anti-Human PKMYT1 Polyclonal Antibody | anti-PKMYT1 antibody

PKMYT1 Antibody - middle region

Cat. Num. AAA3222643

• Gene Names: PKMYT1; MYT1; PPP1R126
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: PKMYT1; Polyclonal Antibody; PKMYT1 Antibody - middle region; anti-PKMYT1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: ISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQR
• Sequence Length: 499

• Applicable Applications for anti-PKMYT1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PKMYT1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PKMYT1Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-PKMYT1 antibody

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein is a membrane-associated kinase that negatively regulates the G2/M transition of the cell cycle by phosphorylating and inactivating cyclin-dependent kinase 1. The activity of the encoded protein is regulated by polo-like kinase 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Product Categories/Family for anti-PKMYT1 antibody

Polyclonal; Protein Kinases; Signaling Intermediate; Membrane Protein; Meiosis/Mitosis/Cell Cycle

NCBI and Uniprot Product Information

• NCBI GI #: 386642875
• NCBI GeneID: 9088
• NCBI Accession #: NP_001245379.1
• NCBI GenBank Nucleotide #: NM_001258450.1
• UniProt Accession #: Q99640
• Molecular Weight: 54 kDa
• NCBI Official Full Name: membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase isoform 3
• NCBI Official Synonym Full Names: protein kinase, membrane associated tyrosine/threonine 1
• NCBI Official Symbol: PKMYT1
• NCBI Official Synonym Symbols: MYT1; PPP1R126
• NCBI Protein Information: membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase
• UniProt Protein Name: Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase
• Protein Family: Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase
• UniProt Gene Name: PKMYT1
• UniProt Synonym Gene Names: MYT1
• UniProt Entry Name: PMYT1_HUMAN

NCBI Description

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein is a membrane-associated kinase that negatively regulates the G2/M transition of the cell cycle by phosphorylating and inactivating cyclin-dependent kinase 1. The activity of the encoded protein is regulated by polo-like kinase 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]

Uniprot Description

Myt1: a dual specificity protein kinase of the WEE family. Preferentially phosphorylates and inactivates cell division cycle 2 protein (CDC2), and thus negatively regulates cell cycle G2/M transition. This kinase is associated with the membrane throughout the cell cycle. Its activity is highly regulated during the cell cycle. Alternative splice-variant isoforms have been reported.

Protein type: EC 2.7.11.1; Kinase, protein; Protein kinase, Other; Protein kinase, dual-specificity (non-receptor); Other group; WEE family

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nucleoplasm; Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; membrane; endoplasmic reticulum; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; metal ion binding; kinase activity; ATP binding; protein kinase activity

Biological Process: mitosis; regulation of cell cycle; regulation of mitosis; regulation of cyclin-dependent protein kinase activity; mitotic cell cycle; G2/M transition of mitotic cell cycle; protein amino acid phosphorylation; G1/S transition of mitotic cell cycle