Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human PUM2 Monoclonal Antibody | anti-PUM2 antibody

PUM2 (Pumilio 2, Pumilio Homolog 2, Pumilio-2, KIAA0235, PUMH2) APC

Gene Names
PUM2; PUMH2; PUML2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PUM2; Monoclonal Antibody; PUM2 (Pumilio 2; Pumilio Homolog 2; Pumilio-2; KIAA0235; PUMH2) APC; anti-PUM2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B6
Specificity
Recognizes human PUM2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
6333
Applicable Applications for anti-PUM2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa701-799 from PUM2 (NP_056132) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVIQKFFEFGSLDQKLALATR*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Testing Data

(Detection limit for recombinant GST tagged PUM2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PUM2 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-PUM2 antibody
PUM2 is a member of the PUF family, evolutionarily conserved RNA-binding proteins related to the Pumilio proteins of Drosophila and the fem-3 mRNA binding factor proteins of C. elegans. This protein contains a sequence-specific RNA binding domain comprised of eight repeats and N- and C-terminal flanking regions, and serves as a translational regulator of specific mRNAs by binding to their 3' untranslated regions. The evolutionarily conserved function of this protein in invertebrates and lower vertebrates suggests that the human protein may be involved in translational regulation of embryogenesis, and cell development and differentiation.
Product Categories/Family for anti-PUM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens pumilio RNA binding family member 2 (PUM2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
pumilio RNA binding family member 2
NCBI Official Symbol
PUM2
NCBI Official Synonym Symbols
PUMH2; PUML2
NCBI Protein Information
pumilio homolog 2
UniProt Protein Name
Pumilio homolog 2
Protein Family
UniProt Gene Name
PUM2
UniProt Synonym Gene Names
KIAA0235; PUMH2; Pumilio-2
UniProt Entry Name
PUM2_HUMAN

NCBI Description

This gene encodes a protein that belongs to a family of RNA-binding proteins. The encoded protein functions as a translational repressor during embryonic development and cell differentiation. This protein is also thought to be a positive regulator of cell proliferation in adipose-derived stem cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

Pumilio-2: Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of mRNA targets. Its interactions and tissue specificity suggest that it may be required to support proliferation and self-renewal of stem cells by regulating the translation of key transcripts. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; Motility/polarity/chemotaxis; Translation

Chromosomal Location of Human Ortholog: 2p24.1

Cellular Component: nuclear membrane; stress granule; perinuclear region of cytoplasm; cytoplasm

Molecular Function: protein binding

Biological Process: regulation of translation; stress granule assembly

Research Articles on PUM2

Similar Products

Product Notes

The PUM2 pum2 (Catalog #AAA6138534) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PUM2 (Pumilio 2, Pumilio Homolog 2, Pumilio-2, KIAA0235, PUMH2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PUM2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PUM2 pum2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PUM2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.