Mouse anti-Human PTPN12 Monoclonal Antibody | anti-PTPN12 antibody

PTPN12 (Tyrosine-protein Phosphatase Non-receptor Type 12, PTP-PEST, Protein-tyrosine Phosphatase G1, PTPG1) (FITC)

Cat. Num. AAA6149128

• Gene Names: PTPN12; PTPG1; PTP-PEST
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTPN12; Monoclonal Antibody; PTPN12 (Tyrosine-protein Phosphatase Non-receptor Type 12; PTP-PEST; Protein-tyrosine Phosphatase G1; PTPG1) (FITC); anti-PTPN12 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G6
• Specificity: Recognizes human PTPN12.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PTPN12 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa682-780, from human PTPN12 (NP_002826) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSENEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEW
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PTPN12 expression in transfected 293T cell line by PTPN12 monoclonal antibody Lane 1: PTPN12 transfected lysate (88.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PTPN12 antibody

This protein is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains a C-terminal PEST motif, which serves as a protein-protein interaction domain, and may be related to protein intracellular half-life. This PTP was found to bind and dephosphorylate the product of oncogene c-ABL, thus may play a role in oncogenesis. This PTP was shown to interact with, and dephosphorylate, various of cytoskeleton and cell adhesion molecules, such as p130 (Cas), CAKbeta/PTK2B, PSTPIP1, and paxillin, which suggested its regulatory roles in controlling cell shape and mobility.

Product Categories/Family for anti-PTPN12 antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 196114951
• NCBI GeneID: 5782
• NCBI Accession #: NP_002826
• NCBI GenBank Nucleotide #: NM_002835
• UniProt Accession #: B4E105; Q05209
• Molecular Weight: 61,229 Da
• NCBI Official Full Name: tyrosine-protein phosphatase non-receptor type 12 isoform 1
• NCBI Official Synonym Full Names: protein tyrosine phosphatase, non-receptor type 12
• NCBI Official Symbol: PTPN12
• NCBI Official Synonym Symbols: PTPG1; PTP-PEST
• NCBI Protein Information: tyrosine-protein phosphatase non-receptor type 12; protein-tyrosine phosphatase G1
• UniProt Protein Name: Protein-tyrosine-phosphatase
• Protein Family: Tyrosine-protein phosphatase non-receptor
• UniProt Entry Name: B4E105_HUMAN