Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PTPN12 expression in transfected 293T cell line by PTPN12 monoclonal antibody Lane 1: PTPN12 transfected lysate (88.1kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PTPN12 Monoclonal Antibody | anti-PTPN12 antibody

PTPN12 (Tyrosine-protein Phosphatase Non-receptor Type 12, PTP-PEST, Protein-tyrosine Phosphatase G1, PTPG1) (AP)

Gene Names
PTPN12; PTPG1; PTP-PEST
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PTPN12; Monoclonal Antibody; PTPN12 (Tyrosine-protein Phosphatase Non-receptor Type 12; PTP-PEST; Protein-tyrosine Phosphatase G1; PTPG1) (AP); anti-PTPN12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G6
Specificity
Recognizes human PTPN12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PTPN12 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa682-780, from human PTPN12 (NP_002826) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSENEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEW
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PTPN12 expression in transfected 293T cell line by PTPN12 monoclonal antibody Lane 1: PTPN12 transfected lysate (88.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PTPN12 expression in transfected 293T cell line by PTPN12 monoclonal antibody Lane 1: PTPN12 transfected lysate (88.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PTPN12 antibody
This protein is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains a C-terminal PEST motif, which serves as a protein-protein interaction domain, and may be related to protein intracellular half-life. This PTP was found to bind and dephosphorylate the product of oncogene c-ABL, thus may play a role in oncogenesis. This PTP was shown to interact with, and dephosphorylate, various of cytoskeleton and cell adhesion molecules, such as p130 (Cas), CAKbeta/PTK2B, PSTPIP1, and paxillin, which suggested its regulatory roles in controlling cell shape and mobility.
Product Categories/Family for anti-PTPN12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,229 Da
NCBI Official Full Name
tyrosine-protein phosphatase non-receptor type 12 isoform 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase, non-receptor type 12
NCBI Official Symbol
PTPN12
NCBI Official Synonym Symbols
PTPG1; PTP-PEST
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 12; protein-tyrosine phosphatase G1
UniProt Protein Name
Protein-tyrosine-phosphatase
UniProt Entry Name
B4E105_HUMAN

Similar Products

Product Notes

The PTPN12 (Catalog #AAA6133219) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTPN12 (Tyrosine-protein Phosphatase Non-receptor Type 12, PTP-PEST, Protein-tyrosine Phosphatase G1, PTPG1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTPN12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTPN12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTPN12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.