Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PTK2 Monoclonal Antibody | anti-PTK2 antibody

PTK2 (Focal Adhesion Kinase 1, FADK 1, Focal Adhesion Kinase-related Nonkinase, FRNK, Protein Phosphatase 1 Regulatory Subunit 71, PPP1R71, Protein-tyrosine Kinase 2, p125FAK, pp125FAK, FAK, FAK1) (MaxLight 405)

Gene Names
PTK2; FAK; FADK; FAK1; FRNK; PPP1R71; p125FAK; pp125FAK
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PTK2; Monoclonal Antibody; PTK2 (Focal Adhesion Kinase 1; FADK 1; Focal Adhesion Kinase-related Nonkinase; FRNK; Protein Phosphatase 1 Regulatory Subunit 71; PPP1R71; Protein-tyrosine Kinase 2; p125FAK; pp125FAK; FAK; FAK1) (MaxLight 405); anti-PTK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C3
Specificity
Recognizes human PTK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-PTK2 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa355-490, from human PTK2 (AAH28733) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PTK2 antibody
Focal adhesion kinase was identified as a 125kD substrate for the intrinsic protein tyrosine kinase activity of Src encoded pp60. The deduced aa sequence of FAK p125 has shown it to be a cytoplasmic protein tyrosine kinase whose sequence and structural organization are unique as compared to other proteins described to date. Localization of p125 by immunofluorescence suggests that it is primarily found in cellular focal adhesions leading to its designation as focal adhesion kinase (FAK). FAK is concentrated at the basal edge of only those basal keratinocytes that are actively migrating and rapidly proliferating in repairing burn wounds and is activated and localized to the focal adhesions of spreading keratinocytes in culture. Thus, it has been postulated that FAK may have an important in vivo role in the reepithelialization of human wounds. FAK protein tyrosine kinase activity has also been shown to increase in cells stimulated to grow by use of mitogenic neuropeptides or neurotransmitters acting through G protein coupled receptors.
Product Categories/Family for anti-PTK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
114,253 Da
NCBI Official Full Name
Homo sapiens PTK2 protein tyrosine kinase 2, mRNA
NCBI Official Synonym Full Names
protein tyrosine kinase 2
NCBI Official Symbol
PTK2
NCBI Official Synonym Symbols
FAK; FADK; FAK1; FRNK; PPP1R71; p125FAK; pp125FAK
NCBI Protein Information
focal adhesion kinase 1
Protein Family

NCBI Description

This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017]

Research Articles on PTK2

Similar Products

Product Notes

The PTK2 (Catalog #AAA6192075) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTK2 (Focal Adhesion Kinase 1, FADK 1, Focal Adhesion Kinase-related Nonkinase, FRNK, Protein Phosphatase 1 Regulatory Subunit 71, PPP1R71, Protein-tyrosine Kinase 2, p125FAK, pp125FAK, FAK, FAK1) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTK2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.