Mouse anti-Human PTK2 Monoclonal Antibody | anti-PTK2 antibody

PTK2 (Focal Adhesion Kinase 1, FADK 1, Focal Adhesion Kinase-related Nonkinase, FRNK, Protein Phosphatase 1 Regulatory Subunit 71, PPP1R71, Protein-tyrosine Kinase 2, p125FAK, pp125FAK, FAK, FAK1) (HRP)

Cat. Num. AAA6154423

• Gene Names: PTK2; FAK; FADK; FAK1; FRNK; PPP1R71; p125FAK; pp125FAK
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTK2; Monoclonal Antibody; PTK2 (Focal Adhesion Kinase 1; FADK 1; Focal Adhesion Kinase-related Nonkinase; FRNK; Protein Phosphatase 1 Regulatory Subunit 71; PPP1R71; Protein-tyrosine Kinase 2; p125FAK; pp125FAK; FAK; FAK1) (HRP); anti-PTK2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C3
• Specificity: Recognizes human PTK2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PTK2 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa355-490, from human PTK2 (AAH28733) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PTK2 monoclonal antibody Western Blot analysis of PTK2 expression in Hela NE.)

Immunoprecipitation (IP)

(Immunoprecipitation of PTK2 transfected lysate using PTK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PTK2 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged PTK2 is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between STAT1 and PTK2 HeLa cells were stained with STAT1 rabbit purified polyclonal 1:1200 and PTK2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-PTK2 antibody

Focal adhesion kinase was identified as a 125kD substrate for the intrinsic protein tyrosine kinase activity of Src encoded pp60. The deduced aa sequence of FAK p125 has shown it to be a cytoplasmic protein tyrosine kinase whose sequence and structural organization are unique as compared to other proteins described to date. Localization of p125 by immunofluorescence suggests that it is primarily found in cellular focal adhesions leading to its designation as focal adhesion kinase (FAK). FAK is concentrated at the basal edge of only those basal keratinocytes that are actively migrating and rapidly proliferating in repairing burn wounds and is activated and localized to the focal adhesions of spreading keratinocytes in culture. Thus, it has been postulated that FAK may have an important in vivo role in the reepithelialization of human wounds. FAK protein tyrosine kinase activity has also been shown to increase in cells stimulated to grow by use of mitogenic neuropeptides or neurotransmitters acting through G protein coupled receptors.

Product Categories/Family for anti-PTK2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 34190616
• NCBI GeneID: 5747
• Molecular Weight: 114,253 Da
• NCBI Official Full Name: Homo sapiens PTK2 protein tyrosine kinase 2, mRNA
• NCBI Official Synonym Full Names: protein tyrosine kinase 2
• NCBI Official Symbol: PTK2
• NCBI Official Synonym Symbols: FAK; FADK; FAK1; FRNK; PPP1R71; p125FAK; pp125FAK
• NCBI Protein Information: focal adhesion kinase 1
• Protein Family: Focal adhesion kinase

NCBI Description

This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017]