Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human PSAT1 Monoclonal Antibody | anti-PSAT1 antibody

PSAT1 (Phosphoserine Aminotransferase, PSAT, PSA, Phosphohydroxythreonine Aminotransferase, EPIP)

Gene Names
PSAT1; PSA; EPIP; PSAT
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Ascites
Ascites
Synonyms
PSAT1; Monoclonal Antibody; PSAT1 (Phosphoserine Aminotransferase; PSAT; PSA; Phosphohydroxythreonine Aminotransferase; EPIP); Anti -PSAT1 (Phosphoserine Aminotransferase; anti-PSAT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1C2
Specificity
Recognizes human PSAT1.
Purity/Purification
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
GGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL
Applicable Applications for anti-PSAT1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa262-371 from human PSAT1 (NP_478059) with GST tag.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)
Product Categories/Family for anti-PSAT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,423 Da
NCBI Official Full Name
phosphoserine aminotransferase isoform 1
NCBI Official Synonym Full Names
phosphoserine aminotransferase 1
NCBI Official Symbol
PSAT1
NCBI Official Synonym Symbols
PSA; EPIP; PSAT
NCBI Protein Information
phosphoserine aminotransferase; endometrial progesterone-induced protein; phosphohydroxythreonine aminotransferase
UniProt Protein Name
Phosphoserine aminotransferase
UniProt Gene Name
PSAT1
UniProt Synonym Gene Names
PSA; PSAT
UniProt Entry Name
SERC_HUMAN

NCBI Description

This gene encodes a member of the class-V pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is a phosphoserine aminotransferase and decreased expression may be associated with schizophrenia. Mutations in this gene are also associated with phosphoserine aminotransferase deficiency. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, and 8. [provided by RefSeq, Jul 2013]

Uniprot Description

PSAT1: Catalyzes the reversible conversion of 3- phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4- phosphonooxybutanoate to phosphohydroxythreonine. Defects in PSAT1 are the cause of phosphoserine aminotransferase deficiency (PSATD). PSATD is characterized biochemically by low plasma and cerebrospinal fluid concentrations of serine and glycine and clinically by intractable seizures, acquired microcephaly, hypertonia, and psychomotor retardation. Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. SerC subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cofactor and Vitamin Metabolism - vitamin B6; EC 2.6.1.52; Amino Acid Metabolism - glycine, serine and threonine; Transferase

Chromosomal Location of Human Ortholog: 9q21.2

Cellular Component: cytoplasm; cytosol

Molecular Function: phosphoserine transaminase activity; pyridoxal phosphate binding

Biological Process: L-serine biosynthetic process; pyridoxine biosynthetic process; amino acid biosynthetic process

Disease: Phosphoserine Aminotransferase Deficiency; Neu-laxova Syndrome 2

Research Articles on PSAT1

Similar Products

Product Notes

The PSAT1 psat1 (Catalog #AAA643078) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PSAT1 (Phosphoserine Aminotransferase, PSAT, PSA, Phosphohydroxythreonine Aminotransferase, EPIP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSAT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the PSAT1 psat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GGAAAMEKLS SIKSQTIYEI IDNSQGFYVC PVEPQNRSKM NIPFRIGNAK GDDALEKRFL DKALELNMLS LKGHRSVGGI RASLYNAVTI EDVQKLAAFM KKFLEMHQL. It is sometimes possible for the material contained within the vial of "PSAT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.