Mouse anti-Human PRSS7 Monoclonal Antibody | anti-PRSS7 antibody

PRSS7 (TMPRSS15, ENTK, PRSS7, Enteropeptidase, Enterokinase, Serine Protease 7, Transmembrane Protease Serine 15, Enteropeptidase Non-catalytic Heavy Chain, Enteropeptidase Catalytic Light Chain, MGC133046) (MaxLight 650)

Cat. Num. AAA6224060

• Gene Names: TMPRSS15; ENTK; PRSS7
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRSS7; Monoclonal Antibody; PRSS7 (TMPRSS15; ENTK; Enteropeptidase; Enterokinase; Serine Protease 7; Transmembrane Protease Serine 15; Enteropeptidase Non-catalytic Heavy Chain; Enteropeptidase Catalytic Light Chain; MGC133046) (MaxLight 650); anti-PRSS7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F8
• Specificity: Recognizes human PRSS7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

• Applicable Applications for anti-PRSS7 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa361-471, from human PRSS7 (NP_002763) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLN
• Conjugate: MaxLight650
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-PRSS7 antibody

This gene encodes an enzyme that converts the pancreatic proenzyme trypsinogen to trypsin, which activates other proenzymes including chymotrypsinogen and procarboxypeptidases. The precursor protein is cleaved into two chains that form a heterodimer linked by a disulfide bond. This protein is a member of the trypsin family of peptidases. Mutations in this gene cause enterokinase deficiency, a malabsorption disorder characterized by diarrhea and failure to thrive.

Product Categories/Family for anti-PRSS7 antibody

Antibodies; Enzymes; Protease (Proteinase; Peptidase)

NCBI and Uniprot Product Information

• NCBI GI #: 223942069
• NCBI GeneID: 5651
• NCBI Accession #: NP_002763
• NCBI GenBank Nucleotide #: NM_002772
• UniProt Accession #: P98073; Q2NKL7
• Molecular Weight: 26.4kDa (237aa)
• NCBI Official Full Name: enteropeptidase
• NCBI Official Synonym Full Names: transmembrane serine protease 15
• NCBI Official Symbol: TMPRSS15
• NCBI Official Synonym Symbols: ENTK; PRSS7
• NCBI Protein Information: enteropeptidase
• UniProt Protein Name: Enteropeptidase
• UniProt Gene Name: TMPRSS15
• UniProt Synonym Gene Names: ENTK; PRSS7
• UniProt Entry Name: ENTK_HUMAN

NCBI Description

This gene encodes an enzyme that converts the pancreatic proenzyme trypsinogen to trypsin, which activates other proenzymes including chymotrypsinogen and procarboxypeptidases. The precursor protein is cleaved into two chains that form a heterodimer linked by a disulfide bond. This protein is a member of the trypsin family of peptidases. Mutations in this gene cause enterokinase deficiency, a malabsorption disorder characterized by diarrhea and failure to thrive. [provided by RefSeq, Jul 2008]

Uniprot Description

PRSS7: Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases. Defects in TMPRSS15 are a cause of enterokinase deficiency (ENTKD); a life-threatening intestinal malabsorption disorder characterized by diarrhea and failure to thrive. Belongs to the peptidase S1 family.

Protein type: EC 3.4.21.9; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 21q21.1

Cellular Component: brush border

Molecular Function: protein binding

Disease: Enterokinase Deficiency