Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PRSS7 is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human PRSS7 Monoclonal Antibody | anti-PRSS7 antibody

PRSS7 (TMPRSS15, ENTK, PRSS7, Enteropeptidase, Enterokinase, Serine Protease 7, Transmembrane Protease Serine 15, Enteropeptidase Non-catalytic Heavy Chain, Enteropeptidase Catalytic Light Chain, MGC133046) (AP)

Gene Names
TMPRSS15; ENTK; PRSS7
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRSS7; Monoclonal Antibody; PRSS7 (TMPRSS15; ENTK; Enteropeptidase; Enterokinase; Serine Protease 7; Transmembrane Protease Serine 15; Enteropeptidase Non-catalytic Heavy Chain; Enteropeptidase Catalytic Light Chain; MGC133046) (AP); anti-PRSS7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F8
Specificity
Recognizes human PRSS7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PRSS7 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa361-471, from human PRSS7 (NP_002763) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PRSS7 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRSS7 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-PRSS7 antibody
This gene encodes an enzyme that converts the pancreatic proenzyme trypsinogen to trypsin, which activates other proenzymes including chymotrypsinogen and procarboxypeptidases. The precursor protein is cleaved into two chains that form a heterodimer linked by a disulfide bond. This protein is a member of the trypsin family of peptidases. Mutations in this gene cause enterokinase deficiency, a malabsorption disorder characterized by diarrhea and failure to thrive.
Product Categories/Family for anti-PRSS7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.4kDa (237aa)
NCBI Official Full Name
enteropeptidase
NCBI Official Synonym Full Names
transmembrane serine protease 15
NCBI Official Symbol
TMPRSS15
NCBI Official Synonym Symbols
ENTK; PRSS7
NCBI Protein Information
enteropeptidase
UniProt Protein Name
Enteropeptidase
UniProt Gene Name
TMPRSS15
UniProt Synonym Gene Names
ENTK; PRSS7
UniProt Entry Name
ENTK_HUMAN

NCBI Description

This gene encodes an enzyme that converts the pancreatic proenzyme trypsinogen to trypsin, which activates other proenzymes including chymotrypsinogen and procarboxypeptidases. The precursor protein is cleaved into two chains that form a heterodimer linked by a disulfide bond. This protein is a member of the trypsin family of peptidases. Mutations in this gene cause enterokinase deficiency, a malabsorption disorder characterized by diarrhea and failure to thrive. [provided by RefSeq, Jul 2008]

Uniprot Description

PRSS7: Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases. Defects in TMPRSS15 are a cause of enterokinase deficiency (ENTKD); a life-threatening intestinal malabsorption disorder characterized by diarrhea and failure to thrive. Belongs to the peptidase S1 family.

Protein type: EC 3.4.21.9; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 21q21.1

Cellular Component: brush border

Molecular Function: protein binding

Disease: Enterokinase Deficiency

Research Articles on PRSS7

Similar Products

Product Notes

The PRSS7 tmprss15 (Catalog #AAA6133171) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRSS7 (TMPRSS15, ENTK, PRSS7, Enteropeptidase, Enterokinase, Serine Protease 7, Transmembrane Protease Serine 15, Enteropeptidase Non-catalytic Heavy Chain, Enteropeptidase Catalytic Light Chain, MGC133046) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRSS7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRSS7 tmprss15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRSS7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.