Mouse PRKCD Monoclonal Antibody | anti-PRKCD antibody

PRKCD (Protein Kinase C, delta, MAY1, MGC49908, PKCD, nPKC-delta) (HRP)

Cat. Num. AAA6179333

• Gene Names: PRKCD; MAY1; PKCD; ALPS3; CVID9; nPKC-delta
• Applications: Western Blot
• Purity: Purified
• Synonyms: PRKCD; Monoclonal Antibody; PRKCD (Protein Kinase C; delta; MAY1; MGC49908; PKCD; nPKC-delta) (HRP); Protein Kinase C; nPKC-delta; anti-PRKCD antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8H6
• Specificity: Recognizes PRKCD.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 676

• Applicable Applications for anti-PRKCD antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PRKCD (NP_006245, 577aa-676aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PRKCD monoclonal antibody (M03), clone 8H6 Western Blot analysis of PRKCD expression in K-562 (Cat # L009V1).)

Testing Data

(Detection limit for recombinant GST tagged PRKCD is approximately 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-PRKCD antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 31377782
• NCBI GeneID: 5580
• NCBI Accession #: NP_006245
• NCBI GenBank Nucleotide #: NP_006245.2
• UniProt Accession #: Q05655
• NCBI Official Full Name: protein kinase C delta type isoform c
• NCBI Official Synonym Full Names: protein kinase C delta
• NCBI Official Symbol: PRKCD
• NCBI Official Synonym Symbols: MAY1; PKCD; ALPS3; CVID9; nPKC-delta
• NCBI Protein Information: protein kinase C delta type
• UniProt Protein Name: Protein kinase C delta type
• Protein Family: Protein kinase
• UniProt Gene Name: PRKCD
• UniProt Synonym Gene Names: SDK1
• UniProt Entry Name: KPCD_HUMAN

NCBI Description

The protein encoded by this gene is a member of the protein kinase C family of serine- and threonine-specific protein kinases. The encoded protein is activated by diacylglycerol and is both a tumor suppressor and a positive regulator of cell cycle progression. Also, this protein can positively or negatively regulate apoptosis. Defects in this gene are a cause of autoimmune lymphoproliferative syndrome. [provided by RefSeq, Aug 2017]

Uniprot Description

PKCD: an AGC kinase of the PKC family. A novel PKC: Ca2 independent but still regulated by PS, DAG and phorbol esters. Caspase-3 appears to liberate a sphingosine-activated catalytic fragment that has altered regulatory mechanisms and substrate specificities.

Protein type: EC 2.7.11.13; Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor); Nuclear receptor co-regulator; Tumor suppressor; Kinase, protein; AGC group; PKC family; Delta subfamily

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: nucleoplasm; nuclear matrix; mitochondrion; endoplasmic reticulum; perinuclear region of cytoplasm; cytoplasm; plasma membrane; intercellular junction; nucleus; cytosol

Molecular Function: calcium-independent protein kinase C activity; protein serine/threonine kinase activity; protein binding; enzyme binding; protein kinase C activity; insulin receptor substrate binding; metal ion binding; enzyme activator activity; non-membrane spanning protein tyrosine kinase activity; ATP binding

Biological Process: B cell proliferation; negative regulation of MAP kinase activity; peptidyl-tyrosine phosphorylation; interleukin-12 production; nerve growth factor receptor signaling pathway; apoptosis; negative regulation of insulin receptor signaling pathway; signal transduction; protein amino acid phosphorylation; positive regulation of protein amino acid dephosphorylation; negative regulation of filopodium formation; positive regulation of superoxide release; regulation of receptor activity; negative regulation of protein binding; cell structure disassembly during apoptosis; epidermal growth factor receptor signaling pathway; platelet activation; negative regulation of peptidyl-tyrosine phosphorylation; fibroblast growth factor receptor signaling pathway; neutrophil activation; protein stabilization; negative regulation of actin filament polymerization; cytokine and chemokine mediated signaling pathway; peptidyl-threonine phosphorylation; cell cycle; phospholipase C activation; negative regulation of inflammatory response; defense response to bacterium; interleukin-10 production; innate immune response; gene expression; immunoglobulin mediated immune response; vascular endothelial growth factor receptor signaling pathway; blood coagulation; induction of apoptosis by oxidative stress

Disease: Autoimmune Lymphoproliferative Syndrome, Type Iii