Western Blot (WB)
(Western Blot detection against Immunogen (36.67kD).)
Mouse anti-Human PPFIA4 Monoclonal Antibody | anti-PPFIA4 antibody
PPFIA4 (Liprin-alpha-4, Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein alpha-4, PTPRF-interacting Protein alpha-4, KIAA0897) (AP)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPFIA4; Monoclonal Antibody; PPFIA4 (Liprin-alpha-4; Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein alpha-4; PTPRF-interacting Protein alpha-4; KIAA0897) (AP); anti-PPFIA4 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B1
Specificity
Recognizes human PPFIA4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PPFIA4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa604-700 from PPFIA4 (NP_055868) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RQVMEREFNNLLALGTDRKLDDGDDKVFRRAPSWRKRFRPREHHGRGGMLSASAETLPAGFRVSTLGTLQPPPAPPKKIMPEAHSHYLYGHMLSAF*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.67kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.67kD).)
Testing Data
(Detection limit for recombinant GST tagged PPFIA4 is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PPFIA4 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-PPFIA4 antibody
May regulate the disassembly of focal adhesions. May localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates.
Product Categories/Family for anti-PPFIA4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Synonym Full Names
PTPRF interacting protein alpha 4
NCBI Official Symbol
PPFIA4
NCBI Protein Information
liprin-alpha-4
UniProt Protein Name
Liprin-alpha-4
Protein Family
UniProt Gene Name
PPFIA4
UniProt Synonym Gene Names
KIAA0897; PTPRF-interacting protein alpha-4
UniProt Entry Name
LIPA4_HUMAN
NCBI Description
PPFIA4, or liprin-alpha-4, belongs to the liprin-alpha gene family. See liprin-alpha-1 (LIP1, or PPFIA1; MIM 611054) for background on liprins.[supplied by OMIM, Mar 2008]
Research Articles on PPFIA4
Similar Products
Product Notes
The PPFIA4 ppfia4 (Catalog #AAA6133081) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPFIA4 (Liprin-alpha-4, Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein alpha-4, PTPRF-interacting Protein alpha-4, KIAA0897) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPFIA4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPFIA4 ppfia4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPFIA4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
