Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human PPFIBP2 Monoclonal Antibody | anti-PPFIBP2 antibody

PPFIBP2 (Liprin-beta-2, Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein-binding Protein 2, PTPRF-interacting Protein-binding Protein 2, DKFZp781K06126, MGC42541) APC

Gene Names
PPFIBP2; Cclp1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPFIBP2; Monoclonal Antibody; PPFIBP2 (Liprin-beta-2; Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein-binding Protein 2; PTPRF-interacting Protein-binding Protein 2; DKFZp781K06126; MGC42541) APC; anti-PPFIBP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A5
Specificity
Recognizes human PPFIBP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PPFIBP2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from PPFIBP2 (NP_003612) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASDASHALEAALEQMDGIIAGTKTGADLSDGTCEPGLASPASYMNPFPVLHLIEDLRLALEMLELPQERAALLSQIPGPTAAYIKEWFEESLSQVNHHS*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(PPFIBP2 monoclonal antibody Western Blot analysis of PPFIBP2 expression in K-562.)

Western Blot (WB) (PPFIBP2 monoclonal antibody Western Blot analysis of PPFIBP2 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged PPFIBP2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPFIBP2 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-PPFIBP2 antibody
May regulate the disassembly of focal adhesions. Did not bind receptor-like tyrosine phosphatases type 2A.
Product Categories/Family for anti-PPFIBP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
liprin-beta-2 isoform 1
NCBI Official Synonym Full Names
PPFIA binding protein 2
NCBI Official Symbol
PPFIBP2
NCBI Official Synonym Symbols
Cclp1
NCBI Protein Information
liprin-beta-2
UniProt Protein Name
Liprin-beta-2
Protein Family
UniProt Gene Name
PPFIBP2
UniProt Synonym Gene Names
PTPRF-interacting protein-binding protein 2
UniProt Entry Name
LIPB2_HUMAN

NCBI Description

This gene encodes a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. The encoded protein is a beta liprin and plays a role in axon guidance and neuronal synapse development by recruiting LAR protein-tyrosine phosphatases to the plasma membrane. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]

Research Articles on PPFIBP2

Similar Products

Product Notes

The PPFIBP2 ppfibp2 (Catalog #AAA6138385) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPFIBP2 (Liprin-beta-2, Protein Tyrosine Phosphatase Receptor Type F Polypeptide-interacting Protein-binding Protein 2, PTPRF-interacting Protein-binding Protein 2, DKFZp781K06126, MGC42541) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPFIBP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPFIBP2 ppfibp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPFIBP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.