Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PPARA Monoclonal Antibody | anti-PPARA antibody

PPARA (Peroxisome Proliferator-activated Receptor alpha, PPAR-alpha, Nuclear Receptor Subfamily 1 Group C Member 1, NR1C1, PPAR, MGC2237, MGC2452) (MaxLight 490)

Gene Names
PPARA; PPAR; NR1C1; hPPAR; PPARalpha
Reactivity
Human
Applications
Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPARA; Monoclonal Antibody; PPARA (Peroxisome Proliferator-activated Receptor alpha; PPAR-alpha; Nuclear Receptor Subfamily 1 Group C Member 1; NR1C1; PPAR; MGC2237; MGC2452) (MaxLight 490); anti-PPARA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A8
Specificity
Recognizes human PPARA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-PPARA antibody
FLISA, Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-259 from human PPARA (AAH00052) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGRSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSGFSWQHGTSVVEDD
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-PPARA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
18,942 Da
NCBI Official Full Name
Homo sapiens peroxisome proliferator-activated receptor alpha, mRNA
NCBI Official Synonym Full Names
peroxisome proliferator-activated receptor alpha
NCBI Official Symbol
PPARA
NCBI Official Synonym Symbols
PPAR; NR1C1; hPPAR; PPARalpha
NCBI Protein Information
peroxisome proliferator-activated receptor alpha; PPAR-alpha; nuclear receptor subfamily 1 group C member 1; peroxisome proliferative activated receptor, alpha; peroxisome proliferator-activated nuclear receptor alpha variant 3

NCBI Description

Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined. [provided by RefSeq, Jul 2008]

Research Articles on PPARA

Similar Products

Product Notes

The PPARA (Catalog #AAA6202615) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPARA (Peroxisome Proliferator-activated Receptor alpha, PPAR-alpha, Nuclear Receptor Subfamily 1 Group C Member 1, NR1C1, PPAR, MGC2237, MGC2452) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPARA can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPARA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPARA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.