Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (40.1kD).)

Mouse anti-Human POLR2J2 Monoclonal Antibody | anti-POLR2J2 antibody

POLR2J2 (DNA-directed RNA Polymerase II Subunit RPB11-b1, RNA Polymerase II Subunit B11-b1, RPB11b1, DNA-directed RNA Polymerase II Subunit J2, MGC105050, MGC54043) (PE)

Gene Names
POLR2J2; HRPB11B; POLR2J3; RPB11b1; RPB11b2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POLR2J2; Monoclonal Antibody; POLR2J2 (DNA-directed RNA Polymerase II Subunit RPB11-b1; RNA Polymerase II Subunit B11-b1; RPB11b1; DNA-directed RNA Polymerase II Subunit J2; MGC105050; MGC54043) (PE); anti-POLR2J2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B2
Specificity
Recognizes human POLR2J2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
115
Applicable Applications for anti-POLR2J2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit for recombinant GST tagged POLR2J2 is 0.3ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-115 from human POLR2J2 (NP_116581) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNAPPAFESFLLFEGEKITINKDTKVPKACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (40.1kD).)

Western Blot (WB)

(Western Blot analysis of POLR2J2 expression in transfected 293T cell line by POLR2J2 monoclonal antibody. Lane 1: POLR2J2 transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of POLR2J2 expression in transfected 293T cell line by POLR2J2 monoclonal antibody. Lane 1: POLR2J2 transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged POLR2J2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged POLR2J2 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-POLR2J2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
DNA-directed RNA polymerase II subunit RPB11-b1
NCBI Official Synonym Full Names
RNA polymerase II subunit J2
NCBI Official Symbol
POLR2J2
NCBI Official Synonym Symbols
HRPB11B; POLR2J3; RPB11b1; RPB11b2
NCBI Protein Information
DNA-directed RNA polymerase II subunit RPB11-b1
UniProt Protein Name
DNA-directed RNA polymerase II subunit RPB11-b1
UniProt Gene Name
POLR2J2
UniProt Synonym Gene Names
RNA polymerase II subunit B11-b1; RPB11b1
UniProt Entry Name
RPB1B_HUMAN

NCBI Description

This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. [provided by RefSeq, Jul 2008]

Uniprot Description

POLR2J2: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft. Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; DNA-binding

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: nucleus

Molecular Function: protein dimerization activity; DNA binding; DNA-directed RNA polymerase activity

Biological Process: transcription, DNA-dependent

Similar Products

Product Notes

The POLR2J2 polr2j2 (Catalog #AAA6159567) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POLR2J2 (DNA-directed RNA Polymerase II Subunit RPB11-b1, RNA Polymerase II Subunit B11-b1, RPB11b1, DNA-directed RNA Polymerase II Subunit J2, MGC105050, MGC54043) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLR2J2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit for recombinant GST tagged POLR2J2 is 0.3ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POLR2J2 polr2j2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POLR2J2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.