Mouse anti-Human POLR2J2 Monoclonal Antibody | anti-POLR2J2 antibody

POLR2J2 (DNA-directed RNA Polymerase II Subunit RPB11-b1, RNA Polymerase II Subunit B11-b1, RPB11b1, DNA-directed RNA Polymerase II Subunit J2, MGC105050, MGC54043) (AP)

Cat. Num. AAA6133052

• Gene Names: POLR2J2; HRPB11B; POLR2J3; RPB11b1; RPB11b2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: POLR2J2; Monoclonal Antibody; POLR2J2 (DNA-directed RNA Polymerase II Subunit RPB11-b1; RNA Polymerase II Subunit B11-b1; RPB11b1; DNA-directed RNA Polymerase II Subunit J2; MGC105050; MGC54043) (AP); anti-POLR2J2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B2
• Specificity: Recognizes human POLR2J2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 115

• Applicable Applications for anti-POLR2J2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit for recombinant GST tagged POLR2J2 is 0.3ng/ml as a capture antibody; Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant protein corresponding to aa1-115 from human POLR2J2 (NP_116581) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNAPPAFESFLLFEGEKITINKDTKVPKACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.1kD).)

Western Blot (WB)

(Western Blot analysis of POLR2J2 expression in transfected 293T cell line by POLR2J2 monoclonal antibody. Lane 1: POLR2J2 transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged POLR2J2 is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-POLR2J2 antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 62739171
• NCBI GeneID: 246721
• NCBI Accession #: NP_116581.3
• NCBI GenBank Nucleotide #: NM_032959
• UniProt Accession #: Q9GZM3
• NCBI Official Full Name: DNA-directed RNA polymerase II subunit RPB11-b1
• NCBI Official Synonym Full Names: RNA polymerase II subunit J2
• NCBI Official Symbol: POLR2J2
• NCBI Official Synonym Symbols: HRPB11B; POLR2J3; RPB11b1; RPB11b2
• NCBI Protein Information: DNA-directed RNA polymerase II subunit RPB11-b1
• UniProt Protein Name: DNA-directed RNA polymerase II subunit RPB11-b1
• Protein Family: DNA-directed RNA polymerase
• UniProt Gene Name: POLR2J2
• UniProt Synonym Gene Names: RNA polymerase II subunit B11-b1; RPB11b1
• UniProt Entry Name: RPB1B_HUMAN

NCBI Description

This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. [provided by RefSeq, Jul 2008]

Uniprot Description

POLR2J2: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft. Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; DNA-binding

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: nucleus

Molecular Function: protein dimerization activity; DNA binding; DNA-directed RNA polymerase activity

Biological Process: transcription, DNA-dependent