Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human POLA Monoclonal Antibody | anti-POLA antibody

POLA (DNA Polymerase alpha Catalytic Subunit, DNA Polymerase alpha Catalytic Subunit p180, POLA1, DKFZp686K1672) (AP)

Gene Names
POLA1; NSX; POLA; p180
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POLA; Monoclonal Antibody; POLA (DNA Polymerase alpha Catalytic Subunit; DNA Polymerase alpha Catalytic Subunit p180; POLA1; DKFZp686K1672) (AP); anti-POLA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C11
Specificity
Recognizes human POLA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-POLA antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1363-1463 from human POLA (NP_058633) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(POLA monoclonal antibody. Western Blot analysis of POLA expression in HeLa NE.)

Western Blot (WB) (POLA monoclonal antibody. Western Blot analysis of POLA expression in HeLa NE.)

Testing Data

(Detection limit for recombinant GST tagged POLA is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged POLA is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-POLA antibody
Plays an essential role in the initiation of DNA replication. During the S phase of the cell cycle, the DNA polymerase alpha complex (composed of a catalytic subunit POLA1/p180, a regulatory subunit POLA2/p70 and two primase subunits PRIM1/p49 and PRIM2/p58) is recruited to DNA at the replicative forks via direct interactions with MCM10 and WDHD1. The primase subunit of the polymerase alpha complex initiates DNA synthesis by oligomerising short RNA primers on both leading and lagging strands. These primers are initially extended by the polymerase alpha catalytic subunit and subsequently transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strand, respectively. The reason this transfer occurs is because the polymerase alpha has limited processivity and lacks intrinsic 3' exonuclease activity for proofreading error, and therefore is not well suited for replicating long complexes.
Product Categories/Family for anti-POLA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
165,913 Da
NCBI Official Full Name
DNA polymerase alpha catalytic subunit isoform 2
NCBI Official Synonym Full Names
DNA polymerase alpha 1, catalytic subunit
NCBI Official Symbol
POLA1
NCBI Official Synonym Symbols
NSX; POLA; p180
NCBI Protein Information
DNA polymerase alpha catalytic subunit
UniProt Protein Name
DNA polymerase alpha catalytic subunit
Protein Family
UniProt Gene Name
POLA1
UniProt Synonym Gene Names
POLA
UniProt Entry Name
DPOLA_HUMAN

NCBI Description

This gene encodes the catalytic subunit of DNA polymerase, which together with a regulatory and two primase subunits, forms the DNA polymerase alpha complex. The catalytic subunit plays an essential role in the initiation of DNA replication. [provided by RefSeq, Mar 2010]

Uniprot Description

POLA: Plays an essential role in the initiation of DNA replication. During the S phase of the cell cycle, the DNA polymerase alpha complex (composed of a catalytic subunit POLA1/p180, a regulatory subunit POLA2/p70 and two primase subunits PRIM1/p49 and PRIM2/p58) is recruited to DNA at the replicative forks via direct interactions with MCM10 and WDHD1. The primase subunit of the polymerase alpha complex initiates DNA synthesis by oligomerising short RNA primers on both leading and lagging strands. These primers are initially extended by the polymerase alpha catalytic subunit and subsequently transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strand, respectively. The reason this transfer occurs is because the polymerase alpha has limited processivity and lacks intrinsic 3' exonuclease activity for proofreading error, and therefore is not well suited for replicating long complexes. Belongs to the DNA polymerase type-B family.

Protein type: DNA replication; DNA repair, damage; Nuclear envelope; EC 2.7.7.7; Nucleotide Metabolism - purine; Transferase; Nucleotide Metabolism - pyrimidine

Chromosomal Location of Human Ortholog: Xp22.1-p21.3

Cellular Component: nucleoplasm; alpha DNA polymerase:primase complex; nuclear matrix; cytoplasm; nucleolus; nuclear envelope; chromatin; nucleus

Molecular Function: protein binding; DNA binding; DNA primase activity; protein heterodimerization activity; 4 iron, 4 sulfur cluster binding; metal ion binding; nucleoside binding; nucleotide binding; DNA-directed DNA polymerase activity; chromatin binding; protein kinase binding

Biological Process: DNA replication initiation; viral reproduction; DNA replication, synthesis of RNA primer; DNA strand elongation during DNA replication; leading strand elongation; DNA repair; lagging strand elongation; double-strand break repair via nonhomologous end joining; telomere maintenance via semi-conservative replication; G1/S-specific transcription in mitotic cell cycle; DNA synthesis during DNA repair; cell proliferation; telomere maintenance via recombination; mitotic cell cycle; DNA replication; telomere maintenance; G1/S transition of mitotic cell cycle

Disease: N Syndrome

Research Articles on POLA

Similar Products

Product Notes

The POLA pola1 (Catalog #AAA6133037) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POLA (DNA Polymerase alpha Catalytic Subunit, DNA Polymerase alpha Catalytic Subunit p180, POLA1, DKFZp686K1672) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POLA pola1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POLA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.