Mouse anti-Human PLXNC1 Monoclonal Antibody | anti-PLXNC1 antibody

PLXNC1 (VESPR, Plexin-C1, Virus-encoded Semaphorin Protein Receptor, CD232) (HRP)

Cat. Num. AAA6154232

• Gene Names: PLXNC1; CD232; VESPR; PLXN-C1
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PLXNC1; Monoclonal Antibody; PLXNC1 (VESPR; Plexin-C1; Virus-encoded Semaphorin Protein Receptor; CD232) (HRP); anti-PLXNC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1A12
• Specificity: Recognizes human PLXNC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1568

• Applicable Applications for anti-PLXNC1 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa250-348 from PLXNC1 (NP_005752) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PLXNC1 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-PLXNC1 antibody

PLXNC1 is a receptor for vaccinia virus semaphorin A39R and for Herpes virus Sema protein. Binding of viral semaphorins triggers cellular responses leading to the rearrangement of the cytoskeleton and to secretion of IL6 and IL8 (By similarity).

Product Categories/Family for anti-PLXNC1 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 5032223
• NCBI GeneID: 10154
• NCBI Accession #: NP_005752
• NCBI GenBank Nucleotide #: NM_005761
• UniProt Accession #: O60486
• NCBI Official Full Name: plexin-C1
• NCBI Official Synonym Full Names: plexin C1
• NCBI Official Symbol: PLXNC1
• NCBI Official Synonym Symbols: CD232; VESPR; PLXN-C1
• NCBI Protein Information: plexin-C1
• UniProt Protein Name: Plexin-C1
• Protein Family: Plexin
• UniProt Gene Name: PLXNC1
• UniProt Synonym Gene Names: VESPR

NCBI Description

This gene encodes a member of the plexin family. Plexins are transmembrane receptors for semaphorins, a large family of proteins that regulate axon guidance, cell motility and migration, and the immune response. The encoded protein and its ligand regulate melanocyte adhesion, and viral semaphorins may modulate the immune response by binding to this receptor. The encoded protein may be a tumor suppressor protein for melanoma. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

Receptor for SEMA7A, for smallpox semaphorin A39R, vaccinia virus semaphorin A39R and for herpesvirus Sema protein. Binding of semaphorins triggers cellular responses leading to the rearrangement of the cytoskeleton and to secretion of IL6 and IL8 ().