Mouse anti-Human PJA2 Monoclonal Antibody | anti-PJA2 antibody

PJA2 (KIAA0438, RNF131, E3 Ubiquitin-protein Ligase Praja-2, RING Finger Protein 131) (HRP)

Cat. Num. AAA6154189

• Gene Names: PJA2; RNF131; Neurodap1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PJA2; Monoclonal Antibody; PJA2 (KIAA0438; RNF131; E3 Ubiquitin-protein Ligase Praja-2; RING Finger Protein 131) (HRP); anti-PJA2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G11
• Specificity: Recognizes human PJA2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 4856

• Applicable Applications for anti-PJA2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa302-400 from PJA2 (NP_055634) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: REKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREALEVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged PJA2 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-PJA2 antibody

PJA2 has E2-dependent E3 ubiquitin-protein ligase activity (By similarity).

Product Categories/Family for anti-PJA2 antibody

Antibodies; Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 1519243450
• NCBI GeneID: 9867
• NCBI Accession #: NM_014819.5
• NCBI GenBank Nucleotide #: NM_014819
• UniProt Accession #: O43164
• NCBI Official Full Name: Homo sapiens praja ring finger ubiquitin ligase 2 (PJA2), mRNA
• NCBI Official Synonym Full Names: praja ring finger ubiquitin ligase 2
• NCBI Official Symbol: PJA2
• NCBI Official Synonym Symbols: RNF131; Neurodap1
• NCBI Protein Information: E3 ubiquitin-protein ligase Praja-2
• UniProt Protein Name: E3 ubiquitin-protein ligase Praja-2
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: PJA2
• UniProt Synonym Gene Names: KIAA0438; RNF131; Praja2
• UniProt Entry Name: PJA2_HUMAN

Uniprot Description

PJA2: Has E2-dependent E3 ubiquitin-protein ligase activity. Responsible for ubiquitination of cAMP-dependent protein kinase type I and type II-alpha/beta regulatory subunits and for targeting them for proteasomal degradation. Essential for PKA- mediated long-term memory processes. Binds ubiquitin-conjugating enzymes (E2s). In vitro, interacts with the ubiquitin-conjugating enzyme, UBE2D2. The phosphorylated form interacts with PRKAR1A, PRKAR2A and PRKAR2B. Binds the catalytic subunits of cAMP-dependent protein kinase. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; EC 6.3.2.19; Ligase; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 5q21.3

Cellular Component: Golgi membrane; postsynaptic membrane; endoplasmic reticulum membrane; cytoplasm; postsynaptic density; plasma membrane; cell junction

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: long-term memory; protein ubiquitination