Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human PJA2 Monoclonal Antibody | anti-PJA2 antibody

PJA2 (KIAA0438, RNF131, E3 Ubiquitin-protein Ligase Praja-2, RING Finger Protein 131) (AP)

Gene Names
PJA2; RNF131; Neurodap1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PJA2; Monoclonal Antibody; PJA2 (KIAA0438; RNF131; E3 Ubiquitin-protein Ligase Praja-2; RING Finger Protein 131) (AP); anti-PJA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G11
Specificity
Recognizes human PJA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
4856
Applicable Applications for anti-PJA2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa302-400 from PJA2 (NP_055634) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
REKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREALEVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged PJA2 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PJA2 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-PJA2 antibody
PJA2 has E2-dependent E3 ubiquitin-protein ligase activity (By similarity).
Product Categories/Family for anti-PJA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens praja ring finger ubiquitin ligase 2 (PJA2), mRNA
NCBI Official Synonym Full Names
praja ring finger ubiquitin ligase 2
NCBI Official Symbol
PJA2
NCBI Official Synonym Symbols
RNF131; Neurodap1
NCBI Protein Information
E3 ubiquitin-protein ligase Praja-2
UniProt Protein Name
E3 ubiquitin-protein ligase Praja-2
UniProt Gene Name
PJA2
UniProt Synonym Gene Names
KIAA0438; RNF131; Praja2
UniProt Entry Name
PJA2_HUMAN

Uniprot Description

PJA2: Has E2-dependent E3 ubiquitin-protein ligase activity. Responsible for ubiquitination of cAMP-dependent protein kinase type I and type II-alpha/beta regulatory subunits and for targeting them for proteasomal degradation. Essential for PKA- mediated long-term memory processes. Binds ubiquitin-conjugating enzymes (E2s). In vitro, interacts with the ubiquitin-conjugating enzyme, UBE2D2. The phosphorylated form interacts with PRKAR1A, PRKAR2A and PRKAR2B. Binds the catalytic subunits of cAMP-dependent protein kinase. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; EC 6.3.2.19; Ligase; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 5q21.3

Cellular Component: Golgi membrane; postsynaptic membrane; endoplasmic reticulum membrane; cytoplasm; postsynaptic density; plasma membrane; cell junction

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: long-term memory; protein ubiquitination

Research Articles on PJA2

Similar Products

Product Notes

The PJA2 pja2 (Catalog #AAA6132977) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PJA2 (KIAA0438, RNF131, E3 Ubiquitin-protein Ligase Praja-2, RING Finger Protein 131) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PJA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PJA2 pja2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PJA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.