Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PIK3R4 monoclonal antibody (M05), clone 2A6. Western Blot analysis of PIK3R4 expression in PC-12 (Cat # L012V1).)

Mouse PIK3R4 Monoclonal Antibody | anti-PIK3R4 antibody

PIK3R4 (Phosphoinositide-3-Kinase, Regulatory Subunit 4, MGC102700, VPS15, p150) (FITC)

Gene Names
PIK3R4; p150; VPS15
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
PIK3R4; Monoclonal Antibody; PIK3R4 (Phosphoinositide-3-Kinase; Regulatory Subunit 4; MGC102700; VPS15; p150) (FITC); Phosphoinositide-3-Kinase; p150; anti-PIK3R4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A6
Specificity
Recognizes PIK3R4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PIK3R4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PIK3R4 (NP_055417, 1259aa-1358aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PIK3R4 monoclonal antibody (M05), clone 2A6. Western Blot analysis of PIK3R4 expression in PC-12 (Cat # L012V1).)

Western Blot (WB) (PIK3R4 monoclonal antibody (M05), clone 2A6. Western Blot analysis of PIK3R4 expression in PC-12 (Cat # L012V1).)
Related Product Information for anti-PIK3R4 antibody
Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
Product Categories/Family for anti-PIK3R4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 149 kDa

Observed: 140 kDa
NCBI Official Full Name
phosphoinositide 3-kinase regulatory subunit 4
NCBI Official Synonym Full Names
phosphoinositide-3-kinase, regulatory subunit 4
NCBI Official Symbol
PIK3R4
NCBI Official Synonym Symbols
p150; VPS15
NCBI Protein Information
phosphoinositide 3-kinase regulatory subunit 4; PI3-kinase p150 subunit; PI3-kinase regulatory subunit 4; phosphoinositide 3-kinase adaptor protein; phosphatidylinositol 3-kinase-associated p150; phosphoinositide-3-kinase, regulatory subunit 4, p150
UniProt Protein Name
Phosphoinositide 3-kinase regulatory subunit 4
UniProt Gene Name
PIK3R4
UniProt Synonym Gene Names
PI3-kinase regulatory subunit 4
UniProt Entry Name
PI3R4_HUMAN

Uniprot Description

PIK3R4: Regulatory subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.

Protein type: EC 2.7.11.1; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Kinase, lipid; Protein kinase, Other; Other group; VPS15 family

Chromosomal Location of Human Ortholog: 3q22.1

Cellular Component: membrane; late endosome; nuclear pore; axoneme; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding; protein kinase activity

Biological Process: macroautophagy; phospholipid metabolic process; late endosome to vacuole transport; toll-like receptor signaling pathway; phosphatidylinositol biosynthetic process; insulin receptor signaling pathway; innate immune response; protein targeting to vacuole; toll-like receptor 9 signaling pathway; peroxisome degradation; protein amino acid phosphorylation

Research Articles on PIK3R4

Similar Products

Product Notes

The PIK3R4 pik3r4 (Catalog #AAA6177634) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PIK3R4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIK3R4 pik3r4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIK3R4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.