Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TRIM63 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Rabbit TRIM63 Polyclonal Antibody | anti-TRIM63 antibody

TRIM63 antibody - middle region

Gene Names
TRIM63; IRF; SMRZ; MURF1; MURF2; RNF28
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRIM63; Polyclonal Antibody; TRIM63 antibody - middle region; anti-TRIM63 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ
Sequence Length
353
Applicable Applications for anti-TRIM63 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRIM63
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TRIM63 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-TRIM63 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)
Related Product Information for anti-TRIM63 antibody
This is a rabbit polyclonal antibody against TRIM63. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is localized to the Z-line and M-line lattices of myofibrils, where titin's N-terminal and C-terminal regions respectively bind to the sarcomere. In vitro binding studies have shown that this protein also binds directly to titin near the region of titin containing kinase activity. Another member of this protein family binds to microtubules. Since these family members can form heterodimers, this suggests that these proteins may serve as a link between titin kinase and microtubule-dependent signal pathways in muscle.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM63
NCBI Official Synonym Full Names
tripartite motif containing 63
NCBI Official Symbol
TRIM63
NCBI Official Synonym Symbols
IRF; SMRZ; MURF1; MURF2; RNF28
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM63
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM63
UniProt Gene Name
TRIM63
UniProt Synonym Gene Names
IRF; MURF1; RNF28; SMRZ; MuRF-1; MuRF1
UniProt Entry Name
TRI63_HUMAN

NCBI Description

This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is an E3 ubiquitin ligase that localizes to the Z-line and M-line lattices of myofibrils. This protein plays an important role in the atrophy of skeletal and cardiac muscle and is required for the degradation of myosin heavy chain proteins, myosin light chain, myosin binding protein, and for muscle-type creatine kinase. [provided by RefSeq, Feb 2012]

Uniprot Description

MURF1: E3 ubiquitin ligase. Regulates proteasomal degradation of cardiac troponin I/TNNI3 and probably of other sarcomeric- associated proteins. May play a role in striated muscle atrophy and hypertrophy by regulating an anti-hypertrophic PKC-mediated signaling pathway. May regulate the organization of myofibrils through TTN in muscle cells.

Protein type: EC 6.3.2.-; Ligase; EC 6.3.2.19; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 1p34-p33

Cellular Component: microtubule; cytoplasm; M band; Z disc; nucleus

Molecular Function: signal transducer activity; protein binding; zinc ion binding; ubiquitin-protein ligase activity; titin binding; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; skeletal muscle atrophy; muscle contraction; regulation of gene expression; protein ubiquitination; response to electrical stimulus involved in regulation of muscle adaptation; signal transduction

Research Articles on TRIM63

Similar Products

Product Notes

The TRIM63 trim63 (Catalog #AAA3206835) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM63 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM63 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIM63 trim63 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQLDKSTKLV ETAIQSLDEP GGATFLLTAK QLIKSIVEAS KGCQLGKTEQ. It is sometimes possible for the material contained within the vial of "TRIM63, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.