Testing Data
(Detection limit for recombinant GST tagged PELP1 is 0.1 ng/ml as a capture antibody.)
Mouse PELP1 Monoclonal Antibody | anti-PELP1 antibody
PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (Biotin)
Gene Names
PELP1; MNAR; P160
Applications
Western Blot
Purity
Purified
Synonyms
PELP1; Monoclonal Antibody; PELP1 (Proline; Glutamate and Leucine Rich Protein 1; HMX3; MNAR; P160) (Biotin); Proline; P160; anti-PELP1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F7
Specificity
Recognizes PELP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1061
Applicable Applications for anti-PELP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PELP1 (AAW80659.1, 337aa-410aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged PELP1 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PELP1 is 0.1 ng/ml as a capture antibody.)
Western Blot (WB)
(HMX3 monoclonal antibody (M01), clone 1F7. Western Blot analysis of PELP1 expression in PC-12.)
Western Blot (WB)
(HMX3 monoclonal antibody (M01), clone 1F7. Western Blot analysis of PELP1 expression in PC-12.)
Related Product Information for anti-PELP1 antibody
PELP1 is a coactivator of estrogen receptor (see ESR1; MIM 133430)-mediated transcription and a corepressor of other nuclear hormone receptors and sequence-specific transcription factors (Choi et al., 2004 [PubMed 15456770]). [supplied by OMIM]
Product Categories/Family for anti-PELP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
transcription factor HMX3
NCBI Official Synonym Full Names
proline, glutamate and leucine rich protein 1
NCBI Official Symbol
PELP1
NCBI Official Synonym Symbols
MNAR; P160
NCBI Protein Information
proline-, glutamic acid- and leucine-rich protein 1
Protein Family
NCBI Description
This gene encodes a transcription factor which coactivates transcription of estrogen receptor responsive genes and corepresses genes activated by other hormone receptors or sequence-specific transcription factors. Expression of this gene is regulated by both members of the estrogen receptor family. This gene may be involved in the progression of several types of cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
Research Articles on PELP1
Similar Products
Product Notes
The PELP1 (Catalog #AAA6174662) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PELP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PELP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PELP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
