Rabbit anti-Human, Mouse ALOX15 Polyclonal Antibody | anti-ALOX15 antibody

ALOX15 (Arachidonate 15-lipoxygenase, 15-LOX, Arachidonate omega-6 Lipoxygenase, LOG15)

Cat. Num. AAA648023

• Gene Names: ALOX15; 15LOX-1; 15-LOX-1
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ALOX15; Polyclonal Antibody; ALOX15 (Arachidonate 15-lipoxygenase; 15-LOX; Arachidonate omega-6 Lipoxygenase; LOG15); Anti -ALOX15 (Arachidonate 15-lipoxygenase; anti-ALOX15 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ALOX15. Species Crossreactivity: mouse.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI

• Applicable Applications for anti-ALOX15 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human ALOX15, aa1-662 (AAH29032.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ALOX15 rabbit polyclonal antibody. Western Blot analysis of ALOX15 expression in mouse spleen.)

Western Blot (WB)

(Western Blot analysis of ALOX15 expression in transfected 293T cell line by ALOX15 polyclonal antibody. Lane 1: ALOX15 transfected lysate (74.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ALOX15 antibody

ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. The protein also acts on C-12 of arachidonate as well as on linoleic acid.

Product Categories/Family for anti-ALOX15 antibody

Antibodies; Abs to Leukotrienes

NCBI and Uniprot Product Information

• NCBI GI #: 40316937
• NCBI GeneID: 246
• NCBI Accession #: NP_001131.3
• NCBI GenBank Nucleotide #: NM_001140.3
• UniProt Accession #: P16050; Q8N6R7; Q99657; A8K2P4
• Molecular Weight: 74,804 Da
• NCBI Official Full Name: arachidonate 15-lipoxygenase
• NCBI Official Synonym Full Names: arachidonate 15-lipoxygenase
• NCBI Official Symbol: ALOX15
• NCBI Official Synonym Symbols: 15LOX-1; 15-LOX-1
• NCBI Protein Information: arachidonate 15-lipoxygenase; 15-LOX; 15-lipooxygenase-1; arachidonate omega-6 lipoxygenase
• UniProt Protein Name: Arachidonate 15-lipoxygenase
• UniProt Gene Name: ALOX15
• UniProt Synonym Gene Names: LOG15; 15-LOX; 15-LOX-1; 12-LOX
• UniProt Entry Name: LOX15_HUMAN

Uniprot Description

Function: Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Converts arachidonic acid into 12-hydroperoxyeicosatetraenoic acid/12-HPETE and 15-hydroperoxyeicosatetraenoic acid/15-HPETE. Also converts linoleic acid to 13-hydroperoxyoctadecadienoic acid. May also act on (12S)-hydroperoxyeicosatetraenoic acid/(12S)-HPETE to produce hepoxilin A3. Probably plays an important role in the immune and inflammatory responses. Through the oxygenation of membrane-bound phosphatidylethanolamine in macrophages may favor clearance of apoptotic cells during inflammation by resident macrophages and prevent an autoimmune response associated with the clearance of apoptotic cells by inflammatory monocytes. In parallel, may regulate actin polymerization which is crucial for several biological processes, including macrophage function. May also regulate macrophage function through regulation of the peroxisome proliferator activated receptor signaling pathway. Finally, it is also involved in the cellular response to IL13/interleukin-13. Beside its role in the immune and inflammatory responses, may play a role in epithelial wound healing in the cornea maybe through production of lipoxin A4. May also play a role in endoplasmic reticulum stress response and the regulation of bone mass. Ref.13

Catalytic activity: Arachidonate + O2 = (5Z,8Z,10E,14Z)-(12S)-12-hydroperoxyicosa-5,8,10,14-tetraenoate. Ref.10Arachidonate + O2 = (5Z,8Z,11Z,13E)-(15S)-15-hydroperoxyicosa-5,8,11,13-tetraenoate. Ref.10

Cofactor: Binds 1 iron ion per subunit

By similarity.

Pathway: Lipid metabolism; hydroperoxy eicosatetraenoic acid biosynthesis.

Subunit structure: Interacts with PEBP1; in response to IL13/interleukin-13, prevents the interaction of PEBP1 with RAF1 to activate the ERK signaling cascade. Ref.13

Subcellular location: Cytoplasm › cytosol. Cell membrane. Lipid droplet. Note: Translocates from the cytosol to the plasma membrane when stimulated by IL13/interleukin-13 and in macrophages binding apoptotic cells. Ref.1 Ref.12 Ref.13

Tissue specificity: Expressed in airway epithelial cells. Ref.13

Induction: Up-regulated by UV-irradiation. Ref.11

Involvement in disease: Disease susceptibility may be associated with variations affecting the gene represented in this entry. Met at position 560 may confer interindividual susceptibility to coronary artery disease (CAD) (Ref.14). Ref.14

Sequence similarities: Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain.