Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human, Rat PDK1 Monoclonal Antibody | anti-PDK1 antibody

PDK1 (3-phosphoinositide-dependent Protein Kinase 1, hPDK1, PDPK1, MGC20087, MGC35290) (AP)

Gene Names
PDPK1; PDK1; PDPK2; PDPK2P; PRO0461
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDK1; Monoclonal Antibody; PDK1 (3-phosphoinositide-dependent Protein Kinase 1; hPDK1; PDPK1; MGC20087; MGC35290) (AP); anti-PDK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E2
Specificity
Recognizes human PDPK1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PDK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa457-557 from human PDPK1 (NP_002604) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(PDPK1 monoclonal antibody. Western Blot analysis of PDPK1 expression in rat brain.)

Western Blot (WB) (PDPK1 monoclonal antibody. Western Blot analysis of PDPK1 expression in rat brain.)

Western Blot (WB)

(PDPK1 monoclonal antibody Western Blot analysis of PDPK1 expression in IMR-32.)

Western Blot (WB) (PDPK1 monoclonal antibody Western Blot analysis of PDPK1 expression in IMR-32.)

Western Blot (WB)

(Western Blot analysis of PDPK1 expression in transfected 293T cell line by PDPK1 monoclonal antibody. Lane 1: PDPK1 transfected lysate (Predicted MW: 48.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PDPK1 expression in transfected 293T cell line by PDPK1 monoclonal antibody. Lane 1: PDPK1 transfected lysate (Predicted MW: 48.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PDK1 antibody
PDK1 or PDPK1 is a 63kD monomeric protein which is also known as Akt kinase. PDK1 is composed of a C-terminal PH (pleckstrin homology) domain and an N-terminal catalytic domain. In response to insulin or insulin-like growth factor, PDK1 phosphorylates PKB/Akt1 on threonine 308 and serine 473 in a phosphatidylinositol 3,4,5-triphosphate or phosphatidylinositol 3,4-biphosphate-dependent manner. Phosphatidylinositol 3,4,5-triphosphate or phosphatidylinositol 3,4-biphosphate binds to the PH domains of PKB and PDK1 resulting in the translocation of these proteins to the cell membrane and activation of PKB. PDK1 also phosphorylates the 70kD ribosomal protein S6 kinase at threonine 229, which is required for its activation. Thus, PDK1 acts upstream of PKB and has been shown to control signals for proliferation and apoptosis.
Product Categories/Family for anti-PDK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
3-phosphoinositide-dependent protein kinase 1 isoform 1
NCBI Official Synonym Full Names
3-phosphoinositide dependent protein kinase 1
NCBI Official Symbol
PDPK1
NCBI Official Synonym Symbols
PDK1; PDPK2; PDPK2P; PRO0461
NCBI Protein Information
3-phosphoinositide-dependent protein kinase 1
UniProt Protein Name
3-phosphoinositide-dependent protein kinase 1
Protein Family
UniProt Gene Name
PDPK1
UniProt Synonym Gene Names
PDK1; hPDK1
UniProt Entry Name
PDPK1_HUMAN

Uniprot Description

PDK1: an AGC kinase of the PKB family that contains a PH domain. Involved in a wide variety of processes including cell proliferation, differentiation and apoptosis. Autophosphorylation in the activation loop is necessary for activity. Phosphorylates and activates kinases including Akt, PKC isozymes, p70 S6K and RSK. Three alternatively-spliced isoforms have been described.

Protein type: Nuclear receptor co-regulator; EC 2.7.11.1; Protein kinase, AGC; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); AGC group; PKB family

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nucleoplasm; cell projection; focal adhesion; membrane; cytoplasm; cytoplasmic membrane-bound vesicle; plasma membrane; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; phospholipase binding; 3-phosphoinositide-dependent protein kinase activity; kinase activity; protein kinase binding; insulin receptor binding; ATP binding; phospholipase activator activity

Biological Process: focal adhesion formation; regulation of mast cell degranulation; nerve growth factor receptor signaling pathway; protein amino acid autophosphorylation; T cell receptor signaling pathway; protein amino acid phosphorylation; synaptic transmission; regulation of transcription, DNA-dependent; regulation of I-kappaB kinase/NF-kappaB cascade; epidermal growth factor receptor signaling pathway; platelet activation; cell migration; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; transcription, DNA-dependent; activation of protein kinase B; calcium-mediated signaling; peptidyl-threonine phosphorylation; hyperosmotic response; cellular response to insulin stimulus; T cell costimulation; insulin receptor signaling pathway; negative regulation of toll-like receptor signaling pathway; negative regulation of protein kinase activity; innate immune response; positive regulation of release of sequestered calcium ion into cytosol; negative regulation of transforming growth factor beta receptor signaling pathway; actin cytoskeleton organization and biogenesis; blood coagulation; vascular endothelial growth factor receptor signaling pathway

Research Articles on PDK1

Similar Products

Product Notes

The PDK1 pdpk1 (Catalog #AAA6132861) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDK1 (3-phosphoinositide-dependent Protein Kinase 1, hPDK1, PDPK1, MGC20087, MGC35290) (AP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDK1 pdpk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.