Mouse anti-Human, Rat PDK1 Monoclonal Antibody | anti-PDK1 antibody

PDK1 (3-phosphoinositide-dependent Protein Kinase 1, hPDK1, PDPK1, MGC20087, MGC35290) (PE)

Cat. Num. AAA6159376

• Gene Names: PDPK1; PDK1; PDPK2; PDPK2P; PRO0461
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PDK1; Monoclonal Antibody; PDK1 (3-phosphoinositide-dependent Protein Kinase 1; hPDK1; PDPK1; MGC20087; MGC35290) (PE); anti-PDK1 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E2
• Specificity: Recognizes human PDPK1. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-PDK1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa457-557 from human PDPK1 (NP_002604) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(PDPK1 monoclonal antibody. Western Blot analysis of PDPK1 expression in rat brain.)

Western Blot (WB)

(PDPK1 monoclonal antibody Western Blot analysis of PDPK1 expression in IMR-32.)

Western Blot (WB)

(Western Blot analysis of PDPK1 expression in transfected 293T cell line by PDPK1 monoclonal antibody. Lane 1: PDPK1 transfected lysate (Predicted MW: 48.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PDK1 antibody

PDK1 or PDPK1 is a 63kD monomeric protein which is also known as Akt kinase. PDK1 is composed of a C-terminal PH (pleckstrin homology) domain and an N-terminal catalytic domain. In response to insulin or insulin-like growth factor, PDK1 phosphorylates PKB/Akt1 on threonine 308 and serine 473 in a phosphatidylinositol 3,4,5-triphosphate or phosphatidylinositol 3,4-biphosphate-dependent manner. Phosphatidylinositol 3,4,5-triphosphate or phosphatidylinositol 3,4-biphosphate binds to the PH domains of PKB and PDK1 resulting in the translocation of these proteins to the cell membrane and activation of PKB. PDK1 also phosphorylates the 70kD ribosomal protein S6 kinase at threonine 229, which is required for its activation. Thus, PDK1 acts upstream of PKB and has been shown to control signals for proliferation and apoptosis.

Product Categories/Family for anti-PDK1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505695
• NCBI GeneID: 5170
• NCBI Accession #: NP_002604
• NCBI GenBank Nucleotide #: NM_002613
• UniProt Accession #: O15530; Q6A1A2
• Molecular Weight: 63kDa
• NCBI Official Full Name: 3-phosphoinositide-dependent protein kinase 1 isoform 1
• NCBI Official Synonym Full Names: 3-phosphoinositide dependent protein kinase 1
• NCBI Official Symbol: PDPK1
• NCBI Official Synonym Symbols: PDK1; PDPK2; PDPK2P; PRO0461
• NCBI Protein Information: 3-phosphoinositide-dependent protein kinase 1
• UniProt Protein Name: 3-phosphoinositide-dependent protein kinase 1
• Protein Family: [Pyruvate dehydrogenase
• UniProt Gene Name: PDPK1
• UniProt Synonym Gene Names: PDK1; hPDK1
• UniProt Entry Name: PDPK1_HUMAN

Uniprot Description

PDK1: an AGC kinase of the PKB family that contains a PH domain. Involved in a wide variety of processes including cell proliferation, differentiation and apoptosis. Autophosphorylation in the activation loop is necessary for activity. Phosphorylates and activates kinases including Akt, PKC isozymes, p70 S6K and RSK. Three alternatively-spliced isoforms have been described.

Protein type: Nuclear receptor co-regulator; EC 2.7.11.1; Protein kinase, AGC; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); AGC group; PKB family

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nucleoplasm; cell projection; focal adhesion; membrane; cytoplasm; cytoplasmic membrane-bound vesicle; plasma membrane; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; phospholipase binding; 3-phosphoinositide-dependent protein kinase activity; kinase activity; protein kinase binding; insulin receptor binding; ATP binding; phospholipase activator activity

Biological Process: focal adhesion formation; regulation of mast cell degranulation; nerve growth factor receptor signaling pathway; protein amino acid autophosphorylation; T cell receptor signaling pathway; protein amino acid phosphorylation; synaptic transmission; regulation of transcription, DNA-dependent; regulation of I-kappaB kinase/NF-kappaB cascade; epidermal growth factor receptor signaling pathway; platelet activation; cell migration; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; transcription, DNA-dependent; activation of protein kinase B; calcium-mediated signaling; peptidyl-threonine phosphorylation; hyperosmotic response; cellular response to insulin stimulus; T cell costimulation; insulin receptor signaling pathway; negative regulation of toll-like receptor signaling pathway; negative regulation of protein kinase activity; innate immune response; positive regulation of release of sequestered calcium ion into cytosol; negative regulation of transforming growth factor beta receptor signaling pathway; actin cytoskeleton organization and biogenesis; blood coagulation; vascular endothelial growth factor receptor signaling pathway