Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PAX7 monoclonal antibody (M06), clone 3H1 Western Blot analysis of PAX7 expression in HeLa.)

Mouse PAX7 Monoclonal Antibody | anti-PAX7 antibody

PAX7 (Paired Box 7, HUP1, PAX7B) (Biotin)

Gene Names
PAX7; HUP1; RMS2; PAX7B
Applications
Western Blot
Purity
Purified
Synonyms
PAX7; Monoclonal Antibody; PAX7 (Paired Box 7; HUP1; PAX7B) (Biotin); Paired Box 7; PAX7B; anti-PAX7 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H1
Specificity
Recognizes PAX7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PAX7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PAX7 (NP_002575.1, 411aa-520aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PAX7 monoclonal antibody (M06), clone 3H1 Western Blot analysis of PAX7 expression in HeLa.)

Western Blot (WB) (PAX7 monoclonal antibody (M06), clone 3H1 Western Blot analysis of PAX7 expression in HeLa.)

Western Blot (WB)

(PAX7 monoclonal antibody (M06), clone 3H1. Western Blot analysis of PAX7 expression in PC-12.)

Western Blot (WB) (PAX7 monoclonal antibody (M06), clone 3H1. Western Blot analysis of PAX7 expression in PC-12.)

Testing Data

(Detection limit for recombinant GST tagged PAX7 is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PAX7 is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-PAX7 antibody
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-PAX7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
55,119 Da
NCBI Official Full Name
Homo sapiens paired box 7 (PAX7), transcript variant 1, mRNA
NCBI Official Synonym Full Names
paired box 7
NCBI Official Symbol
PAX7
NCBI Official Synonym Symbols
HUP1; RMS2; PAX7B
NCBI Protein Information
paired box protein Pax-7; PAX7 transcriptional factor; paired box homeotic gene 7; paired domain gene 7
Protein Family

NCBI Description

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]

Research Articles on PAX7

Similar Products

Product Notes

The PAX7 (Catalog #AAA6171621) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PAX7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAX7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAX7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.