Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen (37.84kD).)

Mouse anti-Human PAX5 Monoclonal Antibody | anti-PAX5 antibody

PAX5 (Paired Box Protein Pax-5, B Cell-specific Transcription Factor, BSAP, PAX-5) (PE)

Gene Names
PAX5; BSAP
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAX5; Monoclonal Antibody; PAX5 (Paired Box Protein Pax-5; B Cell-specific Transcription Factor; BSAP; PAX-5) (PE); anti-PAX5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
8F9
Specificity
Recognizes human PAX5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PAX5 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa192-301 from human PAX5 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against immunogen (37.84kD).)

Western Blot (WB)

(Western Blot analysis of PAX5 expression in IMR-32 using 130905.)

Western Blot (WB) (Western Blot analysis of PAX5 expression in IMR-32 using 130905.)

Western Blot (WB)

(Western Blot analysis of PAX5 expression in transfected 293T cell line by 130905. Lane 1: PAX5 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PAX5 expression in transfected 293T cell line by 130905. Lane 1: PAX5 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase on formalin-fixed paraffin-embedded human tonsil using 130905 (1.5ug/ml).)

Immunohistochemistry (IHC) (Immunoperoxidase on formalin-fixed paraffin-embedded human tonsil using 130905 (1.5ug/ml).)

Testing Data

(Detection limit for 130905 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for 130905 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of PAX5 over-expressed 293 cell line, cotransfected with PAX5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAX5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PAX5 over-expressed 293 cell line, cotransfected with PAX5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAX5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-PAX5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,149 Da
NCBI Official Full Name
paired box protein Pax-5
NCBI Official Synonym Full Names
paired box 5
NCBI Official Symbol
PAX5
NCBI Official Synonym Symbols
BSAP
NCBI Protein Information
paired box protein Pax-5; paired box homeotic gene 5; transcription factor PAX 5; B cell specific activator protein; B-cell lineage specific activator; B-cell-specific transcription factor
UniProt Protein Name
Paired box protein Pax-5
Protein Family
UniProt Gene Name
PAX5
UniProt Synonym Gene Names
BSAP
UniProt Entry Name
PAX5_HUMAN

Uniprot Description

PAX5: May play an important role in B-cell differentiation as well as neural development and spermatogenesis. Involved in the regulation of the CD19 gene, a B-lymphoid-specific target gene. Interacts with DAXX. Binds DNA as a monomer. Binds TLE4.

Protein type: Oncoprotein

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: nucleus

Molecular Function: protein binding

Biological Process: transcription from RNA polymerase II promoter; negative regulation of histone H3-K9 methylation; nervous system development; organ morphogenesis; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; negative regulation of transcription from RNA polymerase II promoter; humoral immune response

Disease: Leukemia, Acute Lymphoblastic, Susceptibility To, 3

Similar Products

Product Notes

The PAX5 pax5 (Catalog #AAA6159291) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PAX5 (Paired Box Protein Pax-5, B Cell-specific Transcription Factor, BSAP, PAX-5) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAX5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAX5 pax5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAX5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.